PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G35570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 949aa    MW: 104878 Da    PI: 6.1239
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G35570.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.84.1e-23143244199
                   EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
            B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                   f+k lt sd++++g +++p++ ae+       ++++++ ++l+++d++ + W++++iyr++++r++lt+GW+ Fv a++Lk+gD+v+F   ++++ +
  OB04G35570.1 143 FCKNLTASDTSTHGGFSVPRRAAEKLfpqldySMQPPN-QELIVRDLHDNMWTFRHIYRGQPKRHLLTTGWSLFVGAKRLKAGDSVLFI--RDEKSQ 236
                   89*********************999*****9555555.49************************************************..456777 PP

                   .EEEEE-S CS
            B3  92 lvvkvfrk 99 
                   l+++v+r+
  OB04G35570.1 237 LLLGVRRA 244
                   89999997 PP

2Auxin_resp115.16.1e-38269351183
    Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                   aahaas+++ F+++YnPr+s+s Fv++v++++ka++++ svGmRf m+fete+ss+rr++Gt+vg+sd+dp+rWp SkWr+L+
  OB04G35570.1 269 AAHAASSGNSFTIYYNPRTSPSPFVIPVARYNKATYMQPSVGMRFAMMFETEESSKRRYTGTIVGISDYDPMRWPSSKWRNLQ 351
                   79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.32E-45133272IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.0E-40136257IPR015300DNA-binding pseudobarrel domain
CDDcd100172.64E-20142243No hitNo description
PfamPF023621.1E-20143244IPR003340B3 DNA binding domain
PROSITE profilePS5086312.689143245IPR003340B3 DNA binding domain
SMARTSM010191.3E-22143245IPR003340B3 DNA binding domain
PfamPF065071.6E-33269351IPR010525Auxin response factor
PfamPF023094.0E-10837933IPR033389AUX/IAA domain
SuperFamilySSF542777.19E-9843925No hitNo description
PROSITE profilePS5174525.501846930IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009908Biological Processflower development
GO:0009942Biological Processlongitudinal axis specification
GO:0010305Biological Processleaf vascular tissue pattern formation
GO:0048364Biological Processroot development
GO:0048507Biological Processmeristem development
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0042802Molecular Functionidentical protein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 949 aa     Download sequence    Send to blast
MASSQEKAKS GVLRNAAALL DEMQLLGEAQ GAKKVINSEL WHACAGPLVC LPQRGSLVYY  60
FPQGHSEQVA ATTRKIPNSR IPKYPNLPSQ LLCQVHNTTL HADKDTDEVY AQMTLQPVNS  120
ETDVFPIPTL GTYTKSKHPT EYFCKNLTAS DTSTHGGFSV PRRAAEKLFP QLDYSMQPPN  180
QELIVRDLHD NMWTFRHIYR GQPKRHLLTT GWSLFVGAKR LKAGDSVLFI RDEKSQLLLG  240
VRRATRQQTT LSSSVLSTDS MHIGVLAAAA HAASSGNSFT IYYNPRTSPS PFVIPVARYN  300
KATYMQPSVG MRFAMMFETE ESSKRRYTGT IVGISDYDPM RWPSSKWRNL QVEWDEHGYG  360
ERPERVSIWD IETPENTLVF PSSTLNSKRQ CLPGYGVPGM EIGSGNISSF QRAQSNPYGN  420
LQHIPAVGSE LAIMLLNQSG QNLGSPLSYQ QSSYSTIIQN VKQSYIPPLE ISNSASSMKQ  480
GSMASDDAQH QFHMANMQNG DLENSEVQPV IDSISESKLN VTSRDPRNTD SYTSRSISEQ  540
NSKGEPSGKT RRSKKGMSHK TISKKSDLSS APSWICDNQQ VGLDSKLVGC DEQVNCENIE  600
DSSGGLTQGN FAGQPHGHQV EENGVLSPPK VESSKSPDGG KSVNSFPNQG CFSQFIDGLD  660
WMTQPSYYQD NNVIHSADAS DNIFSSSADI PPTIIADTME TFQASCLSEC LPNSIQEFIS  720
SPDLNSLTFL SPEMQNLEVQ LQHDGSNLSS TSNSFVQMSF SEESGNLSGL HMESTHRSMN  780
TTSCSQPLST GCFDTGMYSK LPRLKESQIL PLPEIHTNSI ETSACSMDAT EYSLDRSAKP  840
MKPPVRTYTK VQKQGSVGRS IDVTGFRNYH ELRSAIACMF GLQGKLEHPG SSEWKLVYVD  900
YENDVLLVGD DPWEEFINCV RCIRILSPSE VQQMSENGMH VLNDCIQAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A0.01737431390Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00153DAPTransfer from AT1G19850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB04G35570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0712920.0AB071292.1 Oryza sativa OsMP mRNA for Arabidopsis Monopteros-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015692226.10.0PREDICTED: auxin response factor 11
SwissprotQ01K260.0ARFK_ORYSI; Auxin response factor 11
SwissprotQ8S9830.0ARFK_ORYSJ; Auxin response factor 11
TrEMBLJ3M2D20.0J3M2D2_ORYBR; Auxin response factor
STRINGOB04G35570.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86733241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19850.10.0ARF family protein
Publications ? help Back to Top
  1. Shen C, et al.
    Functional analysis of the structural domain of ARF proteins in rice (Oryza sativa L.).
    J. Exp. Bot., 2010. 61(14): p. 3971-81
    [PMID:20693412]
  2. Indoliya Y, et al.
    Decoding regulatory landscape of somatic embryogenesis reveals differential regulatory networks between japonica and indica rice subspecies.
    Sci Rep, 2016. 6: p. 23050
    [PMID:26973288]