PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G33590.1
Common NameLOC102700424
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 396aa    MW: 44810.8 Da    PI: 6.1316
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G33590.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.91.6e-11104142240
                   XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLea 40 
                   +++k+ rr+++NReAAr+sR+RKka+i++Le+   +L +
  OB04G33590.1 104 PPDKVLRRLAQNREAARKSRLRKKAYIQQLETSRLKLAQ 142
                   5799***************************84443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.3E-8102150No hitNo description
SMARTSM003382.3E-10103167IPR004827Basic-leucine zipper domain
PfamPF001702.5E-8105145IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.933105149IPR004827Basic-leucine zipper domain
CDDcd147082.75E-21107156No hitNo description
SuperFamilySSF579596.19E-7109152No hitNo description
PROSITE patternPS000360110125IPR004827Basic-leucine zipper domain
PfamPF141444.1E-26195269IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MELYPGYLED HFNIHKLSIS SPSPPEYMTS ASTQFAAPVR MGAYDRPPPV GMWSHEQFKV  60
DNGQATSAST IMEAEMKFET RLEEIPQVVL DQEGINLDQE ASKPPDKVLR RLAQNREAAR  120
KSRLRKKAYI QQLETSRLKL AQLEQELQRA RQQGVYANGN LQEPNLGFAG SIDPGALGFE  180
IKYSHWVDEQ NRNTGELRNA LLQGQTSELE LKLLVEAGLE NYNHLFKMKE EAANSNVFYV  240
MSGMWKTPTE RFFLWIGGFR PSEVLKNLRP QLEPLTEQQV AEVSGLQQTS MQVEDALSQG  300
MDKLKQTIAD SLTAADPFGS PEAYMVHMTN AVEQLRSLVQ FVTQADHLRQ QTLQEMHKIL  360
KPPQAARGLV ALGDYFQRFR TLSSLWAARP RDSGIS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0737150.0AK073715.1 Oryza sativa Japonica Group cDNA clone:J033059P06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015692188.10.0PREDICTED: transcription factor TGA4-like
RefseqXP_015692187.10.0PREDICTED: transcription factor TGA4-like
SwissprotQ391621e-129TGA4_ARATH; Transcription factor TGA4
TrEMBLJ3M1T40.0J3M1T4_ORYBR; Uncharacterized protein
STRINGOB04G33590.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35713877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-121TGACG motif-binding factor 4