PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G30790.1
Common NameLOC102705618
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LFY
Protein Properties Length: 385aa    MW: 42193.8 Da    PI: 8.5792
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G30790.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY542.81.2e-16513771386
       FLO_LFY   1 mdpea.fsas.lfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslse 95 
                   mdp++ fsa+  f+wd  + a +p   +++    +++      +   ++ rele+l+ +yGvr +tva+i+elGft+stL+ m+++eldd+m++l+ 
  OB04G30790.1   1 MDPNDaFSAAhPFRWDLGPPA-PP--PVAPPP-PPPP-----PVPPVHAPRELEDLVAGYGVRLSTVARISELGFTASTLLAMTERELDDMMAALAG 88 
                   777654776559****64322.22..233222.2222.....344566789********************************************** PP

       FLO_LFY  96 ifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaee.kkseeekkkaskk 191
                   +fr+dll+Ger+G++aa+raer rl++     +++    +++ +++d +sqe+ls+e++     +agsgg+g  +++  ++ + kk+ ++ +  +k 
  OB04G30790.1  89 LFRWDLLLGERFGLRAALRAERGRLMSLG--GRHH---GHQSGSTVDGASQEALSDEHD-----MAGSGGMGDDDNGRRMTMAgKKQAKKGSASRKG 175
                   **************************965..5555...6788889***********977.....556666665555544444312222222222222 PP

       FLO_LFY 192 .kqkrkkkkelkseededeeeeededeeg......sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkv 281
                    k++rkk ++l+ + +ede++ +d+ + +      +g +g erqrehPf+vtepgevar+kknGLDYLf+LyeqCr fLlqvq++ak +G+k+Ptkv
  OB04G30790.1 176 kKARRKKVDDLRLDMQEDENDCDDDGGGSestessAGGGGGERQREHPFVVTEPGEVARAKKNGLDYLFHLYEQCRLFLLQVQSMAKLHGHKSPTKV 272
                   26666666666655444444333332222233444778889******************************************************** PP

       FLO_LFY 282 tnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLC 378
                   tnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeas+alrra+k+rgenvGawrqac++plv+i+ar+g+didavf+ahprL+iWYvPt+LrqLC
  OB04G30790.1 273 TNQVFRYAKKVGASYINKPKMRHYVHCYALHCLDEEASDALRRAYKARGENVGAWRQACFAPLVDISARHGFDIDAVFAAHPRLAIWYVPTRLRQLC 369
                   ************************************************************************************************* PP

       FLO_LFY 379 hlerskas 386
                   h++rs+++
  OB04G30790.1 370 HQARSSHA 377
                   *****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.2E-1901377IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MDPNDAFSAA HPFRWDLGPP APPPVAPPPP PPPPVPPVHA PRELEDLVAG YGVRLSTVAR  60
ISELGFTAST LLAMTERELD DMMAALAGLF RWDLLLGERF GLRAALRAER GRLMSLGGRH  120
HGHQSGSTVD GASQEALSDE HDMAGSGGMG DDDNGRRMTM AGKKQAKKGS ASRKGKKARR  180
KKVDDLRLDM QEDENDCDDD GGGSESTESS AGGGGGERQR EHPFVVTEPG EVARAKKNGL  240
DYLFHLYEQC RLFLLQVQSM AKLHGHKSPT KVTNQVFRYA KKVGASYINK PKMRHYVHCY  300
ALHCLDEEAS DALRRAYKAR GENVGAWRQA CFAPLVDISA RHGFDIDAVF AAHPRLAIWY  360
VPTRLRQLCH QARSSHAAAL PPPLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A2e-982153752162PROTEIN LEAFY
2vy2_A2e-982153752162PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB04G30790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0056200.0AB005620.1 Oryza sativa mRNA for RFL gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006652747.10.0PREDICTED: probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLJ3M1040.0J3M104_ORYBR; Uncharacterized protein
STRINGOB04G30790.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.15e-97floral meristem identity control protein LEAFY (LFY)