PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G30360.1
Common NameLOC102722292
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 633aa    MW: 71153.5 Da    PI: 5.2585
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G30360.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS368.87.4e-1132616312374
          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                   ++lL++cA+a + +d+++ ++lL+++++++s +gd+ qRla++f++AL+arla+++s++y++l++++ts   +++ l+a+kl++ ++P+ k+s++  
  OB04G30360.1 261 TTLLIHCAQATAIDDHRNSNELLKQIRQRSSAYGDAGQRLAHCFANALEARLAGTGSSIYRTLAAKRTS---VADILNAFKLYVTACPFKKISNFFS 354
                   689**************************************************************9999...************************* PP

          GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                    +aIl+a +g  r+Hi+D++i++G+QWp ++q +++Rp+gpps+RiTg++ p++g   ++ +e+tg+rL+++A+ ++vpfe+++ +a +++++++e+
  OB04G30360.1 355 IEAILNASKGVARLHIVDYGIQYGFQWPIFFQRISKRPGGPPSVRITGIDLPQPGfrPAQLIEATGHRLHDYARMFNVPFEYHA-IAAKWDTIRVED 450
                   ******************************************************9*999*************************.799********* PP

          GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                   ++++++E l+Vn+ +++ +++de v+ +s+r +vLk++++++P+++++   +  +n++ F++rf eal yys+lfd+le++++r +e+r  +Er l+
  OB04G30360.1 451 IKIDKDELLVVNCLFRMRNMMDEMVTDDSPRIQVLKTIRKMNPHLFIHGVVNGTYNAPFFVTRFKEALFYYSSLFDMLETTASRVDENRLLIERDLF 547
                   ************************************************************************************************* PP

          GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   gre+ nvvaceg+er+er et+++W+ r  +aGFk++pl+++++k+a++ ++k + + + v+e+++++++gWk+r ++++S W+
  OB04G30360.1 548 GREALNVVACEGTERVERPETYKQWQVRNIRAGFKQLPLNQETVKKARYKVSKSYHRDFLVDEDNKWMLQGWKGRIIFALSTWE 631
                   *******************************************************999*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.114234611IPR005202Transcription factor GRAS
PfamPF035142.6E-110261631IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MFMDSGSYDD VDYGDLFSIP NPPAPHLLNF PLQFFPSNGF PISTGDSHPS PAGLFGSTPS  60
PTSTTTELEN SEDLESADDA VLAYINQFLL EDEEDESCPG TVASVEDPVL LTVEKPFVDI  120
LTASNEACQE NSWIDSCCDF TGNGGLFDML TSTQTTCQTV PCEFQEEKGE CAVHKGRKNP  180
HDDCLLFEEA SRSKQLAVSE EEAIREMFDK VLLCNGECEL RSPLPAEARS CGVYVKGSGN  240
KRGRKRGKSG AAPEDDAVDL TTLLIHCAQA TAIDDHRNSN ELLKQIRQRS SAYGDAGQRL  300
AHCFANALEA RLAGTGSSIY RTLAAKRTSV ADILNAFKLY VTACPFKKIS NFFSIEAILN  360
ASKGVARLHI VDYGIQYGFQ WPIFFQRISK RPGGPPSVRI TGIDLPQPGF RPAQLIEATG  420
HRLHDYARMF NVPFEYHAIA AKWDTIRVED IKIDKDELLV VNCLFRMRNM MDEMVTDDSP  480
RIQVLKTIRK MNPHLFIHGV VNGTYNAPFF VTRFKEALFY YSSLFDMLET TASRVDENRL  540
LIERDLFGRE ALNVVACEGT ERVERPETYK QWQVRNIRAG FKQLPLNQET VKKARYKVSK  600
SYHRDFLVDE DNKWMLQGWK GRIIFALSTW EPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-482646308374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8311370.0CT831137.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA220O22, full insert sequence.
GenBankCP0126120.0CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6629810.0AL662981.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0086O06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006652721.10.0PREDICTED: scarecrow-like protein 9
SwissprotQ9XE581e-168SCL14_ARATH; Scarecrow-like protein 14
TrEMBLJ3M0W10.0J3M0W1_ORYBR; Uncharacterized protein
STRINGOB04G30360.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP138412529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-166SCARECROW-like 14