PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G28790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 268aa    MW: 31306.9 Da    PI: 8.5902
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G28790.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.71.5e-25136185352
        RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   ++i+l d+++yF+lpi +A+++L++++++LKr+CRqy+I+RWPhRkiksl
  OB04G28790.1 136 ASITLVDIAQYFHLPIIEASRTLKIGVSILKRKCRQYNIPRWPHRKIKSL 185
                   78**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.247120205IPR003035RWP-RK domain
PfamPF020421.1E-20137185IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MTSLFFLLGF LGQVFFFPAR DVAMFLCVRA YAGAAVVRSV HGYKVYGRRG RNPRLMCVPS  60
LYNDLKKVFR FQNVENIPKL MQCDSEEKLN SWDAQDKISD EEVHASESDS DDDLQSGEEL  120
KPTVQKQRRA KKKHIASITL VDIAQYFHLP IIEASRTLKI GVSILKRKCR QYNIPRWPHR  180
KIKSLDSLIQ DLEFVIDDDD DTGDDVQKEK DKQTEEEKQE VIQALTRRKE MLETEKEAIQ  240
QVPAMDLKEE TKQFRDDVFK RRHRAKKI
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB04G28790.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126121e-94CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006653678.11e-154PREDICTED: LOW QUALITY PROTEIN: protein RKD5
TrEMBLJ3M0F40.0J3M0F4_ORYBR; Uncharacterized protein
STRINGOB04G28790.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106733142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.13e-37RWP-RK domain-containing protein