PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G27960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 263aa    MW: 27664.1 Da    PI: 9.7928
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G27960.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.82.3e-41104180177
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                   +CqvegC++ l+ +keyhrrhkvCevh+kap v+v+g+eqrfCqqCsrfh l efD++k+sCrrrLa+hnerrr+++
  OB04G27960.1 104 RCQVEGCDVTLTGVKEYHRRHKVCEVHAKAPRVVVHGIEQRFCQQCSRFHVLAEFDDAKKSCRRRLAGHNERRRRSN 180
                   6*************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.4E-34101166IPR004333Transcription factor, SBP-box
PROSITE profilePS5114133.026102179IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.24E-40103182IPR004333Transcription factor, SBP-box
PfamPF031101.1E-32105178IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MEGNGCGGGG SGQTPRGVAG MHWAPVTSAP CPQPFLPPPP CRPDQMQQQG LTCLKLGKRP  60
CFWGGSGTSH AAQGSSAGGG GGGGGGAEGK RKEKAATAAP VVPRCQVEGC DVTLTGVKEY  120
HRRHKVCEVH AKAPRVVVHG IEQRFCQQCS RFHVLAEFDD AKKSCRRRLA GHNERRRRSN  180
ASEAMARGSA HPHGMPMLGH GSPPYGLPTS SAGALSLLSA TRATGPWLIP TPDISARSSA  240
ALDELIAENR AALLSWQFFS DRX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-321051781184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0687490.0AK068749.1 Oryza sativa Japonica Group cDNA clone:J013158C23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006653653.10.0PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ7XT421e-146SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
SwissprotQ01JD11e-146SPL7_ORYSI; Squamosa promoter-binding-like protein 7
TrEMBLJ3M0710.0J3M071_ORYBR; Uncharacterized protein
STRINGOB04G27960.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP103033439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.14e-37squamosa promoter binding protein-like 3