PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G27500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 320aa    MW: 35841.4 Da    PI: 10.3821
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G27500.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY84.59.8e-27161210150
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEE CS
          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvvei 50 
                   ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++
  OB04G27500.1 161 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRLVIT 210
                   59******************************************999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-27146210IPR003657WRKY domain
SuperFamilySSF1182901.22E-23153211IPR003657WRKY domain
PROSITE profilePS5081123.858156210IPR003657WRKY domain
SMARTSM007742.0E-25161211IPR003657WRKY domain
PfamPF031065.0E-20162205IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MEGSQLETAC LPALYAPLGP YTPASASLLA PLPSLQHRLP QLPPLVHEQA AGNHGVMFSS  60
DHGRLYPLLP GIPFCQSSSA AAAAGEKAAG FAPVDAAEAG TSAAAKVDNE IATAATATNC  120
HGYNSWWKGS AAAAEKGKMK VRRKMREPRF CFQTRSDVDV LDDGYKWRKY GQKVVKNSLH  180
PRSYYRCTHS NCRVKKRVER LSEDCRLVIT PRRRPPHPHP LQRRRQLRRR RPHRQLRLHL  240
LLTHAYIWVM VTLCPAAMLH GEADRWSYQG GRDRCKMLGK LARTLTCMLV FPKQSISSSS  300
CIYFMETQAR ISDEVINTKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-18152210866Probable WRKY transcription factor 4
2lex_A1e-18152210866Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1211230RRRPPHPHPLQRRRQLRRRR
2223230RRQLRRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB04G27500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0736951e-173AK073695.1 Oryza sativa Japonica Group cDNA clone:J033063J05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635033.11e-103probable WRKY transcription factor 12
TrEMBLJ3M0250.0J3M025_ORYBR; Uncharacterized protein
STRINGOB04G27500.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP113838130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.12e-52WRKY family protein