PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G24560.1
Common NameLOC102715846
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 935aa    MW: 102059 Da    PI: 6.2685
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G24560.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.92.4e-29566617152
        RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   aek+isl++l+kyFs+++kdAAk+Lgvc+T+LKriCRq+GI+RWP+Rki+++
  OB04G24560.1 566 AEKNISLDVLRKYFSGSLKDAAKSLGVCPTTLKRICRQHGISRWPSRKINKV 617
                   589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.245552637IPR003035RWP-RK domain
PfamPF020422.0E-26569617IPR003035RWP-RK domain
SuperFamilySSF542771.18E-23826917No hitNo description
Gene3DG3DSA:3.10.20.2402.4E-22831912No hitNo description
PROSITE profilePS5174525.528833915IPR000270PB1 domain
SMARTSM006662.5E-21833915IPR000270PB1 domain
PfamPF005641.1E-17834914IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 935 aa     Download sequence    Send to blast
MDMPTPSNHG GCNGNIGSSE VHSEDPYSTA AAMNFDSYSE MCNPSVADQL FSLLNDPAAN  60
RMFAMWSSSM GSSPRGGGMS EDMMLDTYSG LGEAAEEPSQ IMSLNPTEAE RMGNRSGELG  120
SDNGAHQWSS IVPRSVVGNS LADRMLMALS LFRESLGSGA LAQVWMPIEQ EGHLLLSTCD  180
QPFLLDQVLA GYREASRKFV FSAKEEPGLH PGLPGRVFIS GVPEWTSSVL YYHRPEYLRM  240
EHALHHDIRG SLAMPIYDAD KDSCCAVLEL VMKKEKPDFS AEMDNVCNAL QAVNLKAATD  300
SSNQKFYTEN QKVAFTEILD VLRAICHAHM LPLALTWVPT SNGIDGGYVV GKDSTNHSQS  360
GKAILHIHES ACYVNDTNMQ GFLQACANRH LEKGQGIAGR ALKSNLPFFS PDIREYSIED  420
YPLAHHARKF GLHAAVAIRL RSTYTGNDDY ILEFFLPINC RGSEEQQMLL NNLSSTMQRI  480
CKSLRTVYEA EVGKVNACTA AVERKTNENC LPTGHTESSS HGDQPITEAS FQGTSIANKP  540
GAMEPELAEQ VQSSSIGHAE KKRSTAEKNI SLDVLRKYFS GSLKDAAKSL GVCPTTLKRI  600
CRQHGISRWP SRKINKVNRS LKKIQTVINS VHGVDRSLQY DPATGSLVPV VSMPEKSAFP  660
SLDALPTPSV GKTVEDPKSE QGYSSPDGLQ RQCCQLQISD EKKSNDNKFH IGNGNSASYG  720
TNATAKSNSE GTKSPLCPTG AFSALHLKRT DYANPSGSLQ PSSECTRDQI VGRISPSIQQ  780
ADLDMLDDHA AKDKDNMHAS TSGTTDSSSG SASSHSTFKQ NIRCALKDTT SPALTVKATY  840
HGDTVRFKFL PSMGWYHLLE EIAKRFKLPT EAFQLKYRDD EDEWVILAND SDLQECVDVL  900
DSIGSRNVKL QVRDLPCNIG SSGSSTCLQL EAHSS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB04G24560.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1031540.0AK103154.1 Oryza sativa Japonica Group cDNA clone:J033120P08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006652467.10.0PREDICTED: protein NLP2-like isoform X1
SwissprotQ0JC270.0NLP2_ORYSJ; Protein NLP2
TrEMBLJ3LZ810.0J3LZ81_ORYBR; Uncharacterized protein
STRINGOB04G24560.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]