PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G24520.1
Common NameLOC102715009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 276aa    MW: 30103.1 Da    PI: 10.1767
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G24520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1353.1e-1176134563
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                   kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l++l+     l+se+
  OB04G24520.1  76 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLSMLQRDTTGLTSEN 134
                   9************************************************9999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-1872136IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.13974137IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-1176131No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-1176131No hitNo description
PfamPF001701.1E-976134IPR004827Basic-leucine zipper domain
CDDcd147032.63E-2177126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MFEMLFLEAG GKLESPEPAA PLPPPPAPPR HQHSMSMDGS TSLASSAAGV AGRMGADAKK  60
AISDAKLAEL ALVDPKRAKR ILANRQSAAR SKERKMRYIA ELERKVQTLQ TEATTLSAQL  120
SMLQRDTTGL TSENSDLKIR VQTMEQQVRL QDALNDRLRD EIQKLKVATG QVNTSCGKVG  180
NFGLSSFGSA NPQGYQRSHI QSLLAAQQLQ QLQIHSQHQQ QQMHLQQQQQ HLSTLQQQLL  240
QESLPLPGDL KMKGIAAASH AQNAGASESH ALRSEP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR8551961e-146CR855196.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0159F11, complete sequence.
GenBankCP0126121e-146CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankAP0149601e-146AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6066271e-146AL606627.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0067K08, complete sequence.
GenBankAK0644291e-146AK064429.1 Oryza sativa Japonica Group cDNA clone:002-110-C11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006652465.10.0PREDICTED: transcription factor RF2a-like
SwissprotQ040883e-70POF21_ARATH; Probable transcription factor PosF21
TrEMBLJ3LZ770.0J3LZ77_ORYBR; Uncharacterized protein
STRINGOB04G24520.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.13e-69bZIP family protein