PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G23060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 538aa    MW: 57165.2 Da    PI: 7.3245
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G23060.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.13.8e-33398456159
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+++d k v++tYeg+Hnhe
  OB04G23060.1 398 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHQGCLVRKHVERASHDLKSVITTYEGKHNHE 456
                   59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.9E-37383458IPR003657WRKY domain
SuperFamilySSF1182903.27E-29390458IPR003657WRKY domain
PROSITE profilePS5081138.044393458IPR003657WRKY domain
SMARTSM007747.6E-39398457IPR003657WRKY domain
PfamPF031062.9E-25399456IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MEEWKDPNHR GADYLMPPTN FLADAFPPAE ALGREGGGSN VVAAGGFERH GLSVAVGSPP  60
PPEERRSSLP PTPQFGQRFG SGSGSGGGGG GRRLADRRAR GGLINTCSYD CFRAYEMLSK  120
LARNGRFTEL LTSPGGQASP TTGKLHMLGG VNDNDPIRFG APPTEEVSGA FSFKPLNLTS  180
SHYTAAEKSE SLPNNQYQSL PRTQVSVKTE ANTQTAQEAA NQTSQSQLMQ QQQQFNGQVA  240
VVKSGCKISR AAPDNAAGGG ASPPDHGQAA EGDGKGDSAA VQDGAGAATQ FESPDGVDVT  300
SAVSDEVERD EKVTHVLPAA ADGESDELER KRRSHHTHHC LAHLYILCSF HGNAHTRSSE  360
SSESSRKLES CAIEMNTASR AVREPRVVIQ TTSEVDILDD GYRWRKYGQK VVKGNPNPRS  420
YYKCTHQGCL VRKHVERASH DLKSVITTYE GKHNHEVPAA RNSGHPAGGS APPGGGAGSS  480
QPHAGARRPE DRLMIIVSCP LMATGTIHPV SFSALSPEVS SLASSSFFCV VCSLTKFW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-35389459878Probable WRKY transcription factor 4
2lex_A2e-35389459878Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1330334KRRSH
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB04G23060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418431e-119AY341843.1 Oryza sativa (japonica cultivar-group) WRKY2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015691496.10.0PREDICTED: probable WRKY transcription factor 2, partial
TrEMBLJ3LYT10.0J3LYT1_ORYBR; Uncharacterized protein
STRINGOB04G23060.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP207538100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.18e-51WRKY DNA-binding protein 2