PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G21020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 204aa    MW: 23806.1 Da    PI: 10.2026
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G21020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.42.5e-251058250
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                  rien   rqvtf+kRr g+lKKA+ELSvLCda++ vi+fs++gk+ye +
  OB04G21020.1 10 RIENPVHRQVTFCKRRMGLLKKAKELSVLCDADIGVIVFSPHGKIYELA 58
                  8*********************************************965 PP

2K-box57.46.5e-2076172398
         K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGed.LesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                   +++ +s e++ ++  qqe+  L++e++ Lq+++R + G++ +++++l eLq+Le++Le  + +iR++K++++ ++ie l++ke  l+ +n  L++++
  OB04G21020.1  76 EAQIESSEQNISQVVQQEVLFLRQEVDLLQNSLRYMYGDKyINQMNLGELQSLESKLEAWVHNIRTTKMQIMSKEIEMLKNKEGILKAANVILQERI 172
                   56667778888999************************8669*************************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-27175IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.24161IPR002100Transcription factor, MADS-box
CDDcd002658.10E-35273No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-26323IPR002100Transcription factor, MADS-box
PfamPF003194.4E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-263859IPR002100Transcription factor, MADS-box
PfamPF014864.3E-2481172IPR002487Transcription factor, K-box
PROSITE profilePS5129712.21687179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KAKELSVLCD ADIGVIVFSP HGKIYELATN  60
GNMAGLIERY KSNLQEAQIE SSEQNISQVV QQEVLFLRQE VDLLQNSLRY MYGDKYINQM  120
NLGELQSLES KLEAWVHNIR TTKMQIMSKE IEMLKNKEGI LKAANVILQE RILLAINFFR  180
ETALFKILFC SCRNLFRIRI RILK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB04G21020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288322.12e-99MADS-box transcription factor 26-like
SwissprotQ2QW559e-73MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLJ3LY771e-146J3LY77_ORYBR; Uncharacterized protein
STRINGOB04G21020.11e-147(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-55AGAMOUS-like 12