PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G47050.1
Common NameLOC102700694
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 967aa    MW: 105469 Da    PI: 5.6226
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G47050.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.4e-41153230178
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   +CqvegC+adl+ +++yhrrhkvCe+hska++++v ++ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  OB03G47050.1 153 TCQVEGCTADLTAVRDYHRRHKVCEMHSKASTAVVGNIVQRFCQQCSRFHPLQEFDEGKRSCRRRLAGHNRRRRKTRP 230
                   6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.1E-34146215IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.436151228IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-38152232IPR004333Transcription factor, SBP-box
PfamPF031102.8E-30154227IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.33E-7754858IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.3E-7756862IPR020683Ankyrin repeat-containing domain
CDDcd002043.17E-8759858No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 967 aa     Download sequence    Send to blast
MEAARVGAQS RHLYGGGLGE PDLVDRREKR LVGWDLNDWR WDSERFAATP VPAREASGLA  60
LNSSPSSSEE AGAAAVRNVN VRGDSDKRKR VVVIDDDDVE DDDLVVENGG GSLSLRIGGG  120
AIAPGAGMDG GADEEDRNGK KIRVQGGSSS GPTCQVEGCT ADLTAVRDYH RRHKVCEMHS  180
KASTAVVGNI VQRFCQQCSR FHPLQEFDEG KRSCRRRLAG HNRRRRKTRP EVAVGGTALT  240
EDKVSSYLLL GLLGVCANLN ADNAEHLRGQ ELLSNLLRNL GAVAKSLDPK ELCKLLEACQ  300
SMQDGSNAGT SEAANALPNT TVLEAAGPSN SKMPFVNSDQ CGLASSSAVQ VQSKSPTVAT  360
PDPPACKFKD FDLNDTCGDM ESFEGGYEGS PTPAFKTADS PNCPLWIHQD TTQSPPQTSG  420
TSDSTSIQSL SSSNGDAQCR TDKIVFKLFE KVPSDLPPVL RSQILGWLSS SPTDIESYIR  480
PGCIILTVYL RLVESAWKEL SDNMSSYLHK LLNSSTGNFW ESGLVFVMVR HQIAFMHNGQ  540
VMLDRPLAKS SHNYCKILCL KPIAAPLSTK VNFRVEGFNL VSASSRLICS FEGHCIFQED  600
TDNIVDDDEH DDIEYLNFSC SLPGSRGRGF LEVEDGGFSN GFFPFIIAEQ DICSEVCELE  660
SIFESSSHEQ ADDDNARNQA LEFINELGWL LHRANVISKH DEVPLASFNI WRFRNLGIFA  720
MEREWCAVTK VLLDFLFIGL VDMGSQSPEE VVLSENLVHT AVRRKSARMV RFLLGYKPNE  780
SLKATAATYL FRPDAQGPSK FTPLHIAAAT DGAEDVLDAL TDDPGLVGIH AWRNARDDAG  840
FTPEDYARQR GNDAYLNMVE KKINKHLGKG HIVVGVPSGV HPVITDGVKP GGEVSLEIGA  900
ASRCNACSRQ ALMYRHSTAT TFLYRPAMLT VMGIAVICVC VGILLHTCPK VYAAPTFRWE  960
LLERGAM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-32147227484squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0698470.0AK069847.1 Oryza sativa Japonica Group cDNA clone:J023034C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006650854.10.0PREDICTED: squamosa promoter-binding-like protein 6
SwissprotQ75LH60.0SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLJ3LUH90.0J3LUH9_ORYBR; Uncharacterized protein
STRINGOB03G47050.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1