PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G39390.1
Common NameLOC102719939
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 500aa    MW: 53816.9 Da    PI: 4.562
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G39390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS346.93.4e-1061315003374
          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                   + Ll+c +a ++ d  la a La ++  a+ +gdp +Rla+yf+ AL +rl     ++ +  ++ ++++  s+e +  +k++++++P+ kf+hltaN
  OB03G39390.1 131 QSLLSCSRAAAT-DPGLAAAELASVRAAATDAGDPSERLAFYFADALTRRLEC---GTGAPPSVAADARFASDELTLCYKTLNDACPYSKFAHLTAN 223
                   7899**998776.89999999*******************************8...5555556666666669999********************** PP

          GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                   qaIlea+  ++++Hi+Df+i qG+QW+aLlqaLa+Rpeg+p ++RiTg+ sp  g   + +l +t  rL++fA+ lgv+fef + + + +++l+ ++
  OB03G39390.1 224 QAILEATGAATKIHIVDFGIVQGIQWAALLQALATRPEGKPtRIRITGIPSPFLGpqPAASLAATSTRLRDFAKLLGVDFEFVP-LLQPVHELDQSD 319
                   *************************************88777*********988888999************************.599********* PP

          GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                   + v+p+Ea+aVn++lql++ll +s +l     +vL+l kslsP vv++ e e+++n++ F++rf++al+yy +lf+sl++ + r+s er+ vEr ++
  OB03G39390.1 320 FLVEPDEAVAVNFMLQLYHLLGDSDELVR---RVLRLAKSLSPAVVTLGEYEVSLNRAGFVDRFANALSYYRSLFESLDVAMTRDSPERVRVERWMF 413
                   *********************88888877...***************************************************************** PP

          GRAS 291 greivnvva.cegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                   g++i+ +v   ega+r+er+    +W+  +e +GF+pv+ls++a +qa+lll +++ +  y++ e   +++ l W++rpL++vSaWr
  OB03G39390.1 414 GERIQRAVGpEEGADRTERMAGSCEWQTLMEWSGFEPVRLSNYARSQADLLLWNYDsKYKYSLVELPPAFLsLAWEKRPLLTVSAWR 500
                   ********8356889*****************************************7778999999999988**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.47103478IPR005202Transcription factor GRAS
PfamPF035141.2E-103131500IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MPQAQAPSSH GQIPAALSYG GAAWPGGEHF FADAFGASAG DAVFSDLAAA ADFDSDGWME  60
SLIGDAPFQD SDLERLIFTT PPPPVPSPPP AHAAARPEPA PALLPLPTAS TPVACSSPSS  120
ADASCSAPIL QSLLSCSRAA ATDPGLAAAE LASVRAAATD AGDPSERLAF YFADALTRRL  180
ECGTGAPPSV AADARFASDE LTLCYKTLND ACPYSKFAHL TANQAILEAT GAATKIHIVD  240
FGIVQGIQWA ALLQALATRP EGKPTRIRIT GIPSPFLGPQ PAASLAATST RLRDFAKLLG  300
VDFEFVPLLQ PVHELDQSDF LVEPDEAVAV NFMLQLYHLL GDSDELVRRV LRLAKSLSPA  360
VVTLGEYEVS LNRAGFVDRF ANALSYYRSL FESLDVAMTR DSPERVRVER WMFGERIQRA  420
VGPEEGADRT ERMAGSCEWQ TLMEWSGFEP VRLSNYARSQ ADLLLWNYDS KYKYSLVELP  480
PAFLSLAWEK RPLLTVSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A0.01265001375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006650515.10.0PREDICTED: scarecrow-like protein 4
SwissprotQ9FL031e-151SCL4_ARATH; Scarecrow-like protein 4
TrEMBLJ3LSB30.0J3LSB3_ORYBR; Uncharacterized protein
STRINGOB03G39390.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85693748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-144GRAS family protein