PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G38500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GeBP
Protein Properties Length: 247aa    MW: 26742.7 Da    PI: 6.4223
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G38500.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57340.57.5e-134534897
        DUF573 48 kvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                   +s+sql+eK+rrLK+Kf+++++++ +g +p+  ++hd+++++l++++W+
  OB03G38500.1  4 PYSRSQLSEKLRRLKNKFRGMSARVGRGLDPARLAPHDRDVLHLCSRLWD 53
                  6899*********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.2E-11453IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MPQPYSRSQL SEKLRRLKNK FRGMSARVGR GLDPARLAPH DRDVLHLCSR LWDTANAATS  60
PFAAGDASSG NKRRRAAPRA GQLTLPDPSG DSNSHDYNGV SSGTPGAFED GHGEEMMYLE  120
QESAHFGYHG DTATVDDGSL HGIVKEQPDA LFALPNIGDV AVPIENGNGK AVVPHSNEHL  180
MANAVLDMFE ECLREVKSNG VFCSTNVNGS AEGSELAKRW RAQRIDELDV LSRRLRLLVE  240
DAAAAGR
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB03G38500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651736.10.0PREDICTED: uncharacterized protein LOC102711246
TrEMBLJ3LS240.0J3LS24_ORYBR; Uncharacterized protein
STRINGOB03G38500.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.24e-07DNA-binding storekeeper protein-related transcriptional regulator