PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G35930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 154aa    MW: 16935 Da    PI: 10.1155
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G35930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26058.81.5e-186512045100
        DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                     k++p ++r da+sslvyeA+ar+rdP+yG+vg i++lqqq+e l+a+lal+++e
  OB03G35930.1  65 KKKDIPVQHRGDAVSSLVYEANARVRDPIYGCVGAISSLQQQVEALQAQLALAQAE 120
                   45678999********************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.2499121IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-1667118IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MSASSSRPQF VSVYVLHKND LSSATSTLLC FAGNSLFILQ HIWLGKFLLM AMLLGTISVS  60
VNGKKKKDIP VQHRGDAVSS LVYEANARVR DPIYGCVGAI SSLQQQVEAL QAQLALAQAE  120
MVRLRMSNDY ISRRLRPMLL LICLVLFLGL VANL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-174612339113LOB family transfactor Ramosa2.1
5ly0_B7e-174612339113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB03G35930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1391741e-93AC139174.3 Oryza sativa chromosome 3 BAC OSJNBb0065L20 genomic sequence, complete sequence.
GenBankAP0149591e-93AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126111e-93CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015690001.17e-36PREDICTED: LOB domain-containing protein 4-like, partial
SwissprotQ8LBW33e-23LBD12_ARATH; LOB domain-containing protein 12
TrEMBLJ3LRB71e-107J3LRB7_ORYBR; Uncharacterized protein
STRINGOB03G35930.11e-108(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-16LOB domain-containing protein 4
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]