PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G24510.1
Common NameLOC102722378
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 169aa    MW: 18486.3 Da    PI: 9.2499
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G24510.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.81.7e-112263547
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47
                  +   rk +NR++ArrsR +K+++++ L  +v++L  eN+a + 
  OB03G24510.1 22 Q-RNRKKSNRLSARRSRMKKQQYVDGLSVEVEQLRRENDATRA 63
                  3.45778*******************************98665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-121681IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.1E-111871No hitNo description
PROSITE profilePS502179.9211982IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-92170No hitNo description
PfamPF001702.7E-82162IPR004827Basic-leucine zipper domain
CDDcd147025.58E-142272No hitNo description
PROSITE patternPS0003602539IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MSVAPVPEGA RRAAAAIEEE RQRNRKKSNR LSARRSRMKK QQYVDGLSVE VEQLRRENDA  60
TRAGVGAVLQ RCGLVEQENR VLLAHARELC STLQLRTSQL RLLGEVASVT LDVPDVADHL  120
MQLYGGGAGA GGLVMPLSPP PPPLPPQIQM LLQSDVMHTV SMLQGYESI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126111e-133CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649961.11e-119PREDICTED: ocs element-binding factor 1-like
TrEMBLJ3LN251e-118J3LN25_ORYBR; Uncharacterized protein
STRINGOB03G24510.11e-118(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125042837
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.19e-12basic leucine-zipper 44