PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G23270.1
Common NameLOC102703564
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 231aa    MW: 24378.5 Da    PI: 6.3391
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G23270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601292.1e-40571561100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCkvlrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++kll++lpe  r da+ss+vyeAear+rdPvyG++g + +lq++ ++lk++la++
  OB03G23270.1  57 PCAACKVLRRRCADGCVLAPYFPPTEPAKFTTAHRVFGASNIIKLLQDLPEGARADAVSSMVYEAEARLRDPVYGCAGAVCRLQKEANELKVQLARA 153
                   7**********************************************************************************************99 PP

        DUF260  98 kee 100
                   ++ 
  OB03G23270.1 154 QAD 156
                   875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.10456157IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-4057154IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MDAAGGNTAA KVTVARAQDY GRSVSPPSRV SSCSPPPPPV GALMAGDDTS TTVVLSPCAA  60
CKVLRRRCAD GCVLAPYFPP TEPAKFTTAH RVFGASNIIK LLQDLPEGAR ADAVSSMVYE  120
AEARLRDPVY GCAGAVCRLQ KEANELKVQL ARAQADLLNA QAQHANLVAL VCVELANHRR  180
GDQQLYQAPP PSSSHHPAEY GVGASFGAAA YQPLYDSDMD SAAWDEAQLW A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-405615910113LOB family transfactor Ramosa2.1
5ly0_B1e-405615910113LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB03G23270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0725150.0AK072515.1 Oryza sativa Japonica Group cDNA clone:J023131K07, full insert sequence.
GenBankCT8321430.0CT832143.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN027J24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649894.11e-169PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR03e-61LBD1_ARATH; LOB domain-containing protein 1
TrEMBLJ3LMQ11e-167J3LMQ1_ORYBR; Uncharacterized protein
STRINGOB03G23270.11e-168(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-64LOB domain-containing protein 1