PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G16630.1
Common NameLOC102717599
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 311aa    MW: 33810 Da    PI: 4.6519
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G16630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.21.4e-1868120456
                   -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   ++++  eq+++Le+ Fe +++++ ++++++A+ +gL+ rqV vWFqNrRa++k
  OB03G16630.1  68 KRRLALEQVRALERSFETDNKLDPDRKARIARDIGLQPRQVAVWFQNRRARWK 120
                   4467789*********************************************9 PP

2HD-ZIP_I/II127.17.7e-4166158193
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                   ekkrrl+ eqv++LE+sFe+++kL+p+rK+++ar++glqprqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e++e
  OB03G16630.1  66 EKKRRLALEQVRALERSFETDNKLDPDRKARIARDIGLQPRQVAVWFQNRRARWKTKQLERDFAALRSRHDALRADCDALRRDKDALAAEIRE 158
                   69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-1954124IPR009057Homeodomain-like
SMARTSM003897.4E-1965126IPR001356Homeobox domain
PROSITE profilePS5007116.34266122IPR001356Homeobox domain
CDDcd000864.77E-1767123No hitNo description
PfamPF000467.9E-1668120IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.7E-2074121IPR009057Homeodomain-like
PRINTSPR000316.8E-593102IPR000047Helix-turn-helix motif
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
PRINTSPR000316.8E-5102118IPR000047Helix-turn-helix motif
PfamPF021831.1E-15122163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MKRPASSRKS KKPGEKLAFA EEDSLVAATM EQQDEADLED VDDADDDEDM AGGHAAPSSS  60
SCGLGEKKRR LALEQVRALE RSFETDNKLD PDRKARIARD IGLQPRQVAV WFQNRRARWK  120
TKQLERDFAA LRSRHDALRA DCDALRRDKD ALAAEIRELR EKLSKPADTK AASVKVEAGN  180
DAATGAAATT ACKDGSSDDS DSSVVFNEEP SPYSGAAFEQ HPQQQQPGFI GFAASFLDTP  240
AATLGCSSLP ALESKWHGSY SYDSYKGGGY AFTEEWLAAS GEVGNDAASF FSDEHVSNLN  300
FGWCASGNEG W
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114122RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB03G16630.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1015220.0AK101522.1 Oryza sativa Japonica Group cDNA clone:J033046N04, full insert sequence.
GenBankAK1016010.0AK101601.1 Oryza sativa Japonica Group cDNA clone:J033051J21, full insert sequence.
GenBankAK1056440.0AK105644.1 Oryza sativa Japonica Group cDNA clone:001-200-F05, full insert sequence.
GenBankCT8310390.0CT831039.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA023E12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649529.10.0PREDICTED: homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-142HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLJ3LKT70.0J3LKT7_ORYBR; Uncharacterized protein
STRINGOB03G16630.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.27e-33homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]