PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G15440.1
Common NameLOC102701618
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bHLH
Protein Properties Length: 157aa    MW: 17632.8 Da    PI: 6.3443
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G15440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH20.58.7e-07851241554
                   HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
           HLH  15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 
                   +i +  ++L++llP+a   ++ ++  + +L+++++YI+sL
  OB03G15440.1  85 QISDLVSKLQDLLPEARLRSNDRMPSSRVLQETCNYIRSL 124
                   789999*********8899*******************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.103.3E-869143IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.05570124IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.03E-884145IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MACGCQMIGE ETSQHRHTSE SDMHCESFSH LQGQYTSSRT YTTLPVLPSL ISPTFLRLLP  60
PTLADMSSRR SRSRQSGSSR ITDEQISDLV SKLQDLLPEA RLRSNDRMPS SRVLQETCNY  120
IRSLHQEVDD LSERLSELLA SSDMSSAQAA IIRSLLM
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB03G15440.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0695691e-145AK069569.1 Oryza sativa Japonica Group cDNA clone:J023022K12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649473.11e-109PREDICTED: transcription factor ILI6
RefseqXP_006649475.11e-109PREDICTED: transcription factor ILI6
RefseqXP_015691117.11e-109PREDICTED: transcription factor ILI6
RefseqXP_015691118.11e-109PREDICTED: transcription factor ILI6
RefseqXP_015691119.11e-109PREDICTED: transcription factor ILI6
RefseqXP_015691120.11e-109PREDICTED: transcription factor ILI6
TrEMBLJ3LKG81e-107J3LKG8_ORYBR; Uncharacterized protein
STRINGOB03G15440.11e-108(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.14e-20bHLH family protein