PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G12460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 898aa    MW: 101031 Da    PI: 7.9108
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G12460.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.52.6e-28576626252
        RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   ek++sl+dl+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  OB03G12460.1 576 EKTVSLQDLRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 626
                   799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.029565646IPR003035RWP-RK domain
PfamPF020426.5E-26578626IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2404.4E-26798882No hitNo description
SuperFamilySSF542778.1E-23798882No hitNo description
SMARTSM006669.3E-26800883IPR000270PB1 domain
PROSITE profilePS5174523.437800883IPR000270PB1 domain
PfamPF005646.0E-18801882IPR000270PB1 domain
CDDcd064075.35E-43801882No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 898 aa     Download sequence    Send to blast
MRDERNGRYR RRRPGSHGGV PAGDAGARFV GVLASRRVPG SEPLLPAVRP RQQRHRLDSS  60
PRXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  120
XXXXXLTTCG QPFWLDRRNH RLASYRSVSM KYQFSADESS RADLGLPGRV FVGRVPEWTP  180
DVRYFSNEEY PRVQHAQYFD IRGSIALPVF EPRSRACLGV VELVMTTQKI NYSTEIENIC  240
SALKEVDLRS SDVSSDPRSK VVDTSYRAIV PEIMDVLRAV CDTHNLPLAQ TWIPCICQAK  300
RGTRHSDERF KYCVSTVDEA CYVRDCSVLG FHQACAEHHL FRGEGIVGKA FGTNEPCFSP  360
DITAYSKTQY PLSHHAKLFS LRAAVAIRLR SVRTGNLDFV LEFFLPLKCI KTEEQRAMLN  420
SLSNTIQQVC YTLRVVTPKE LVNDEPFEVS QPTRPEFYAK SVHENLDELC SGINVPGRTT  480
TLEASEEVSS WIAGLADAQK GAKGEIDVPF EFSKHDDEGF SVTAGWHTSL VIAPEGSIFS  540
GFKHHEDYDV KENTCSSDPS HSNSDKAVEK RRTKTEKTVS LQDLRKHFAG SLKEAAKNLG  600
VCPTTLKRIC RQHGINRWPS RKIKKVGHSL KKLQMVIDSV HGPEGTVQLS SLYENFTKTT  660
WSERELQGNA IFPASEQNFQ LEPSIPDRPC EGRFTSHTSG SNSLSPSCSH SSNSSLGCSS  720
GPKPQQQHGS APQLAVKQEI SMEEIHGSTP IKSASHAEAE LQMFVEERPA TLFRSQSQVL  780
VSEHKQTENM SNMQKARSDS LKIKAIYGEE RCIFRLQPSW SFQRLKEEIV KRFGIAQDTH  840
VDLKYLDDES EWVLLTCDAD LLECIDVYKS SSNQTVRILV NPSIQPVLGA SFGQTGLS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1813YRRRRP
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB03G12460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000460.0AK100046.1 Oryza sativa Japonica Group cDNA clone:J013153P10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651009.20.0PREDICTED: protein NLP1-like
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLJ3LJM00.0J3LJM0_ORYBR; Uncharacterized protein
STRINGOB03G12460.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]