PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G12130.1
Common NameLOC102701244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 209aa    MW: 23118.2 Da    PI: 9.1018
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G12130.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.95.9e-1061118562
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                   kr +r   NR +A rs +RK  +i+eLe+kv+ L++e ++L  ++  l+  +a l ++
  OB03G12130.1  61 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQSEATKLSTQVTILQRDSAGLATQ 118
                   999***************************************9998888887777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.5E-1757121IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.89859122IPR004827Basic-leucine zipper domain
PfamPF001702.2E-961119IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-1161118No hitNo description
SuperFamilySSF579591.41E-1161112No hitNo description
CDDcd147032.16E-1862113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MDSLIGKFNF TATAAAAAAN GAGLGPNRFS LEFGSGEFTT VEMKKIMADE KLAEMALADP  60
KRVKRVLANR QSAARSKERK MRYIAELEQK VQILQSEATK LSTQVTILQR DSAGLATQNN  120
ELKFRLQAME QQAHLRDALN EALTTEVQRL KLATAELGDT CSSSGLVQQI QLNTQNQMFQ  180
LQQPQQAIPF YQLQQTQQNG AAKNNEANE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7281661e-137KJ728166.1 Zea mays clone pUT6436 bZIP transcription factor (bZIP64) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649313.11e-150PREDICTED: transcription factor RF2a-like
SwissprotQ69IL44e-50RF2A_ORYSJ; Transcription factor RF2a
TrEMBLJ3LJI71e-150J3LJI7_ORYBR; Uncharacterized protein
STRINGOB03G12130.11e-150(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.36e-66bZIP family protein