PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G45490.1
Common NameLOC102715456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 141aa    MW: 15109.1 Da    PI: 9.3149
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G45490.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.64.8e-1767126160
                   XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                   e+e ++++r++kNRe+A rsR+RK+a+++eLe++v  L +eN +Lk   ++lk e+a+l 
  OB02G45490.1  67 EEEERKTIRMMKNRESALRSRARKRAYVQELEKEVHRLVNENLKLKRHCKQLKTEMAALI 126
                   678899***********************************************9999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.7E-1765126No hitNo description
PRINTSPR000412.4E-56682IPR001630cAMP response element binding (CREB) protein
PfamPF001701.9E-1467125IPR004827Basic-leucine zipper domain
SMARTSM003381.4E-1467131IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.48469125IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.9E-1371127No hitNo description
CDDcd147077.29E-1671125No hitNo description
PRINTSPR000412.4E-584104IPR001630cAMP response element binding (CREB) protein
PRINTSPR000412.4E-5104121IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MADQLGGMGS PQLSLSSCSS FLSISSAGNS AADGAPHLSL GVGGAEELDL LMQVGIGGGG  60
GGGGDEEEEE RKTIRMMKNR ESALRSRARK RAYVQELEKE VHRLVNENLK LKRHCKQLKT  120
EMAALIQPTT KQSSHRRSSS T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0610860.0AK061086.1 Oryza sativa Japonica Group cDNA clone:006-206-G05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006648186.15e-98PREDICTED: protein FD-like
TrEMBLJ3LIT26e-98J3LIT2_ORYBR; Uncharacterized protein
STRINGOB02G45490.12e-97(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.12e-13bZIP family protein