PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G41370.1
Common NameLOC102708214
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 390aa    MW: 42603.4 Da    PI: 7.4015
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G41370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.4e-2589132144
           WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                   d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  OB02G41370.1  89 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 132
                   79***************************************998 PP

2QLQ58.61.9e-201752237
           QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                  +FTa+Q+q+L++Q+l+yKy+a++ P+P++L+ ++++
  OB02G41370.1 17 PFTASQWQELEHQALIYKYMASGTPIPSDLIIPLRR 52
                  9******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-101652IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.0E-151750IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.5071752IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57389133IPR014977WRC domain
PfamPF088792.1E-2090132IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MMMMSGRPSG GAGGRYPFTA SQWQELEHQA LIYKYMASGT PIPSDLIIPL RRSFLLDSAL  60
ATSPSLAFPP QPSLGWGCFG MGFGRKAEDP EPGRCRRTDG KKWRCSKEAY PDSKYCEKHM  120
HRGKNRSRKP VEMSLATPPP SSSASSPASN ASAGAGAGAT TTSSPAPSYN RPAAHDAAPY  180
QALYGGPYAA ATARTPAAAA FHPQVSPFHL HLDTTHPHPP PSYYSMDHKE YAVYGHTAKE  240
VHGEHAFFSD GTERDHHAAS HGQWQFKQLG MEPKQSTTTL FPGTGYGNTA ASPYAIDLSK  300
EDDEEKERRQ QQQQHCFLLG ADLRLEKPVG HDPAAAAQKP LRHFFDEWPH EKSTKGSWMG  360
LEGETQLSMS IPMATNDLPI TATSAYHHDD
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB02G41370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2018950.0AF201895.1 Oryza sativa growth-regulating factor 1 (GRF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647996.10.0PREDICTED: growth-regulating factor 1
SwissprotQ6AWY80.0GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLJ3LHM00.0J3LHM0_ORYBR; Uncharacterized protein
STRINGOB02G41370.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.19e-55growth-regulating factor 5