PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G40680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 186aa    MW: 20410.2 Da    PI: 9.073
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G40680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.71.6e-15126175554
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                   +r+rr++kNRe+A rsRqRK+a++ eLe +v++L++ N++L+k+ +e+ +
  OB02G40680.1 126 RRQRRMIKNRESAARSRQRKQAYMMELEAEVAKLKELNEELQKKQDEILE 175
                   79****************************************99888655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-11122180IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.3124176IPR004827Basic-leucine zipper domain
PfamPF001707.4E-14126176IPR004827Basic-leucine zipper domain
CDDcd147073.32E-25126178No hitNo description
Gene3DG3DSA:1.20.5.1704.4E-15126176No hitNo description
SuperFamilySSF579593.94E-11126175No hitNo description
PROSITE patternPS000360129144IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MDFPGGSGRP QQQQLPPMTP LPLARQGSVY SLTFDEFQST LGGVGKDFGS MNMDELLRSI  60
WTAEESHAGG GGVAPLVSPV RPVSSNGFGK MEGGDLSSLS PSPVPYIFNG GLRGRKAPGI  120
EKVVERRQRR MIKNRESAAR SRQRKQAYMM ELEAEVAKLK ELNEELQKKQ DEILEQQKNE  180
GFGGCI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7796381e-123KP779638.1 Oryza nivara OsbZIP23 (bZIP23) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015688745.11e-113PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q41e-41AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLJ3LHF11e-133J3LHF1_ORYBR; Uncharacterized protein
STRINGOB02G40680.11e-133(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.12e-28abscisic acid responsive elements-binding factor 2