PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G39310.1
Common NameLOC102704315
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 223aa    MW: 26128.8 Da    PI: 7.0482
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G39310.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.45e-27106155352
        RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   k +++e +s+yF +pik+AA+eL+v+lT+LKr+CR +GI+RWPhRk+ksl
  OB02G39310.1 106 KPLTFELVSQYFCMPIKQAARELNVGLTLLKRRCRVLGIPRWPHRKMKSL 155
                   789*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.33788175IPR003035RWP-RK domain
PfamPF020425.2E-22108155IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MEDRIFHEDD SLFQDLSFDF LQQDDALFST RHFCTSVSTQ GILLQDEPDA FFTGDILSIW  60
DEMEQGTYLS HQKSDKDSDE NAQKLEIGKA MELQRRRPSG HGSEAKPLTF ELVSQYFCMP  120
IKQAARELNV GLTLLKRRCR VLGIPRWPHR KMKSLDTLIR SVEEIGEQTG QLKDKARNAV  180
EMLQQKKKLI EQKPDVELDD WTKTLRQMYF KKNYKRRVLA IEK
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB02G39310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649045.11e-166PREDICTED: protein RKD1-like
SwissprotQ9M9U91e-35RKD1_ARATH; Protein RKD1
TrEMBLJ3LH141e-164J3LH14_ORYBR; Uncharacterized protein
STRINGOB02G39310.11e-165(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-37RWP-RK domain-containing protein