PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G35300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 600aa    MW: 62441.7 Da    PI: 8.229
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G35300.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS230.86.3e-712525422296
          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                   ++lL e+A a+++g+ + a + L+ l+  a+p+gd+ qRl+++++ AL++r+       + + ++++ ++  s e+ aa +l+++vsP++ ++   a
  OB02G35300.1 252 RHLLSEAAAAIADGNYSTAASHLSVLKLAANPRGDAEQRLVTMMVAALSSRVGT-----APSGQSQHRADLYSGEHRAACQLLQDVSPCFGLALHGA 343
                   79**************************************************98.....333344444444499999******************** PP

          GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                   N aIl+av+g++++H +Dfd+s  +Q ++L++aLa+R+ ++ sl++T+v++p+s      +++l +t erL k+A++ g++f+f++ v+ r +++e 
  OB02G35300.1 344 NLAILDAVAGHRAIHLVDFDVSA-AQHVPLIKALADRRVPSTSLKVTVVADPASPfkpaMTQALAATSERLGKLAQQAGIDFRFRA-VSCRAAEIEA 438
                   *********************85.8**************************9988899999*************************.7889****** PP

          GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                   ++L ++pgEalaVnl++ l r++desvs  ++rde+L+ v+ l P+vv++veqe+++n++++ +r+++a+ +y a+++sl+a+l+r+s +r+  E++
  OB02G35300.1 439 SKLGCEPGEALAVNLAFTLSRVPDESVSPVNPRDELLRRVRALGPRVVTLVEQELNTNTAPLPARLSDACAHYGAVMESLDATLGRDSVDRARAEAA 535
                   ***********************************************************************************************99 PP

          GRAS 289 llgreivn 296
                    l++++ n
  OB02G35300.1 536 -LANKVAN 542
                   .6666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.582225600IPR005202Transcription factor GRAS
PfamPF035142.2E-68252542IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MDQAGAPWCD HRRGYGGVGP AVQAPVPRSD GVGGAGGVLK RSLGEMERWQ QQRQVAAQQA  60
MYLRSVRQRT GALQPMDYGA VLGGVASPAY GISGLSSGFG GISPQPSSTA LSSLTTASRT  120
VVPVMQMQQL QRQMVAVPAA HSPAVARGPA ARPATATELV LLQELEKQLL GDDEEEAADA  180
AGSGCGSSIT SSDWGNTIQT LNSITAASSP SPPLPTAVNN TALLARSPTN SSSSTASSSA  240
SSSPPISTAS SRHLLSEAAA AIADGNYSTA ASHLSVLKLA ANPRGDAEQR LVTMMVAALS  300
SRVGTAPSGQ SQHRADLYSG EHRAACQLLQ DVSPCFGLAL HGANLAILDA VAGHRAIHLV  360
DFDVSAAQHV PLIKALADRR VPSTSLKVTV VADPASPFKP AMTQALAATS ERLGKLAQQA  420
GIDFRFRAVS CRAAEIEASK LGCEPGEALA VNLAFTLSRV PDESVSPVNP RDELLRRVRA  480
LGPRVVTLVE QELNTNTAPL PARLSDACAH YGAVMESLDA TLGRDSVDRA RAEAALANKV  540
ANAPLSPLVR SSEPVHTHLK ITLAVISLLL PEMTPNIFVT RSRVSVTYRS SDKYVSVICI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-292545338284GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2244260.0AY224426.1 Oryza sativa (japonica cultivar-group) isolate 20145 scarecrow transcriptional regulator-like protein mRNA, complete cds.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0041780.0AP004178.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1123_G04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006648938.10.0PREDICTED: scarecrow-like protein 8
TrEMBLJ3LFW30.0J3LFW3_ORYBR; Uncharacterized protein
STRINGOB02G35300.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-59SCARECROW-like 8