PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G28170.1
Common NameLOC102699936
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 674aa    MW: 74727.1 Da    PI: 6.5499
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G28170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.42.7e-23125225198
                   EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
            B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                   f+k+lt sd++++g +++ +++aee+       ++++ +  +l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F   + +++
  OB02G28170.1 125 FCKTLTASDTSTHGGFSVLRRHAEEClppldmtQNPPWQ--ELVARDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFL--RGENG 217
                   99****************************986555545..8************************************************..44999 PP

                   ..EEEEE- CS
            B3  91 elvvkvfr 98 
                   el+v+v+r
  OB02G28170.1 218 ELRVGVRR 225
                   9*****97 PP

2Auxin_resp109.63.2e-36251333183
    Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                   a+ha+st++ F+v+Y+Pr+s+seFvv+++k+++a ++k+svGmRfkm+fe+++++err+sGt++gv  + ++ W nS WrsLk
  OB02G28170.1 251 ASHAISTGTLFSVFYKPRTSQSEFVVSLNKYLEAKNSKISVGMRFKMRFEGDEAPERRFSGTIIGVGSMPTSPWANSDWRSLK 333
                   789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.62E-44115254IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.9E-41121240IPR015300DNA-binding pseudobarrel domain
CDDcd100177.64E-22123225No hitNo description
PfamPF023625.3E-21125225IPR003340B3 DNA binding domain
SMARTSM010191.5E-22125227IPR003340B3 DNA binding domain
PROSITE profilePS5086311.462125227IPR003340B3 DNA binding domain
PfamPF065074.1E-34251333IPR010525Auxin response factor
PfamPF023092.8E-12536635IPR033389AUX/IAA domain
PROSITE profilePS5174525.21545638IPR000270PB1 domain
SuperFamilySSF542779.16E-12546624No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MASSGAAAAG GGTGNSCDAL YRELWHACAG PLVTVPRRGE LVYYFPQGHM EQLEASTDQQ  60
LDQHLPMFNL PSKILCKVVN VELRAETDSD EVYAQIMLHP ESDQNEPTKP QPDPHEPEKC  120
NVHSFCKTLT ASDTSTHGGF SVLRRHAEEC LPPLDMTQNP PWQELVARDL HGNEWHFRHI  180
FRGQPRRHLL TTGWSVFVSS KRLVAGDAFI FLRGENGELR VGVRRLMRQL NNMPSSVISS  240
HSMHLGVLAT ASHAISTGTL FSVFYKPRTS QSEFVVSLNK YLEAKNSKIS VGMRFKMRFE  300
GDEAPERRFS GTIIGVGSMP TSPWANSDWR SLKVQWDEPS VVPRPDRVSP WELEPLAVSN  360
TQPLPQPPAR NKRARPPASN SIAPELPPVF GLWKSPAEST QGFSFSGLQR THELYPSSPN  420
SIFSTSLNVG FSTKNESSAL TNKHFYWPMR ETRADSYSVS INKVPSEKKR EPSSAGCRLF  480
GIEIGSAVEA TSPVPAVSGV GQDQPAASVD AESDQLSQPS HANKSDAPAA SSEPSPHETQ  540
SRPVRSCTKV IMQGMAVGRA VDLTRLHGYD DLRCKLEEMF DIQGELAASL KKWKVVYTDD  600
EDDMMLVGDD PWPEFCSMVK RIYIYTYEEA KQLIPKSKLP IIGDAKQNPN KQSPESDMPH  660
SDLDSTTPVT DKDC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.013561355Auxin response factor 1
4ldw_A0.013561355Auxin response factor 1
4ldw_B0.013561355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB02G28170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0700260.0AK070026.1 Oryza sativa Japonica Group cDNA clone:J023036G16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006648743.10.0PREDICTED: auxin response factor 7
SwissprotQ6YVY00.0ARFG_ORYSJ; Auxin response factor 7
TrEMBLJ3LDV00.0J3LDV0_ORYBR; Auxin response factor
STRINGOB02G28170.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108236116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]