PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G19350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 195aa    MW: 21665.3 Da    PI: 10.8876
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G19350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.42.4e-113579549
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49
                  kr +r   NR +A+rsR RK+++i eLe+ v +L+ e +aL  ++
  OB02G19350.1 35 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQMEVSALSPRV 79
                  899*********************************999998666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-133195IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.6113389IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-123589No hitNo description
SuperFamilySSF579596.54E-123589No hitNo description
PfamPF001704.1E-103585IPR004827Basic-leucine zipper domain
CDDcd147032.36E-193686No hitNo description
PROSITE patternPS0003603853IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MDMGEGDDGL AATSPAGAGA MAAAAAAADG IADPKRVKRI LANRQSAQRS RVRKLQYISE  60
LERSVTTLQM EVSALSPRVA FLDHQRSLLT VGNSHLKQRI AALAQDKIFK DAHQDALKKE  120
IERLRQLYHH QQIKATRGAX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  180
XXXXXXXXXG GAAIR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0974721e-127FP097472.1 Phyllostachys edulis cDNA clone: bphylf047m15, full insert sequence.
GenBankFP0962471e-127FP096247.1 Phyllostachys edulis cDNA clone: bphyst038a13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015688537.13e-93PREDICTED: basic leucine zipper 19-like
SwissprotQ6K3R94e-68BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLJ3LBB83e-94J3LBB8_ORYBR; Uncharacterized protein
STRINGOB02G19350.18e-94(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-56bZIP family protein