PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G12720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 539aa    MW: 56562.4 Da    PI: 5.0875
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G12720.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.81.2e-29296346252
        RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   ek+i+le+l+kyFs+++kdAA++Lgvc+T++KriCRq+GI+RWP+Rki+++
  OB02G12720.1 296 EKSITLEELQKYFSGSLKDAARSLGVCPTTMKRICRQHGIPRWPFRKISKV 346
                   799*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.064285366IPR003035RWP-RK domain
PfamPF020422.3E-26298346IPR003035RWP-RK domain
SuperFamilySSF542773.92E-19426497No hitNo description
SMARTSM006667.4E-18430527IPR000270PB1 domain
PROSITE profilePS5174517.006430527IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2407.1E-23431497No hitNo description
CDDcd064074.98E-35431526No hitNo description
PfamPF005641.3E-12431500IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MVVVEVEADA VDHLDVILAA GGRRCVSGRS EGGGGSPARE EEEEAAVAVK ERIARALRLY  60
KEAAGDGGGG WLVQCYGSGE YARISYALIY DIQGSLALPV LDPATASCLA VLELVTAAPL  120
LRVSGELANL CNALQAVSLR GVGICNPAAA VTNRDAARAA MAEVSELLAA VCEAHRLPLA  180
QAWLFLPPDC TGVAEQKAAV DAVSATINAC SGDLKAIAIS NLEDLFLDSV ADGDQQLRHE  240
MDDLGDDQRC SDEDDLLLAV ENATIGELKI QSEDQIRGEV HGSQAGKNKT RRGKTEKSIT  300
LEELQKYFSG SLKDAARSLG VCPTTMKRIC RQHGIPRWPF RKISKVNRSL DKMKRVMESV  360
NCSPSPPVAM PAHPALLLPP PPAPAPPPPP RPCLSSTLGE ASSHGSCQAP PPAKAAALAR  420
PPRRGNGDGV VTIKASYRGD IVRFRVPCSA GVAAVKAEVA KRLSLDAGGF DVKYLDDDHE  480
WVLLSCDADF QECLDVVPAL PSMSAAAAAK SGSGAAVQVV RLMVQEVADN IGSSCASSD
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB02G12720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0054740.0AP005474.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0081C13.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646856.20.0PREDICTED: protein NLP3-like
TrEMBLJ3L9F50.0J3L9F5_ORYBR; Uncharacterized protein
STRINGOB02G12720.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62692939
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.13e-32Nin-like family protein