PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G52900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 379aa    MW: 41998.8 Da    PI: 7.5401
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G52900.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS156.32.7e-488326673241
          GRAS  73 nsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfA 169
                   + +e++aa++ f +++P+l+++  +aNq Ilea+e+e+ vH+iD++    +QW+ Ll+ La+Rpegpp+lR+T v++    +k+ l++t+  L+k A
  OB01G52900.1  83 TPAEVAAARRHFLDLCPFLRLAGAAANQSILEAMESEKIVHVIDLGGADATQWLELLHLLAARPEGPPHLRLTSVHE----HKDLLSQTAMALTKEA 175
                   467899999********************************************************************....9*************** PP

          GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll....................desvsleserdevLklvkslsPkvvvv 241
                   e+l+vpf+fn+ v++rl++l++e+Lrvk+gEala++++lqlh ll                    +   +++s+ d++L ++++lsPk + v
  OB01G52900.1 176 ERLDVPFQFNP-VVSRLDALDVESLRVKTGEALAICSSLQLHCLLasdddatagaatdkdrrspeSGLSPSTSRADAFLGALWGLSPKAMAV 266
                   ***********.7***********************************************9997522233344789************9977 PP

2GRAS28.42e-09346374346374
          GRAS 346 sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    dg++v ee+g ++l+W+dr+L+svSaWr
  OB01G52900.1 346 CDGFKVREEKGNFFLCWQDRALFSVSAWR 374
                   68**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098525.9731379IPR005202Transcription factor GRAS
PfamPF035149.3E-4683266IPR005202Transcription factor GRAS
PfamPF035147.1E-7346374IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MDDAGAALRR AGTLPHSSPP QLRXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  60
XXXXXXXXXX XXXXXXLPRS SPTPAEVAAA RRHFLDLCPF LRLAGAAANQ SILEAMESEK  120
IVHVIDLGGA DATQWLELLH LLAARPEGPP HLRLTSVHEH KDLLSQTAMA LTKEAERLDV  180
PFQFNPVVSR LDALDVESLR VKTGEALAIC SSLQLHCLLA SDDDATAGAA TDKDRRSPES  240
GLSPSTSRAD AFLGALWGLS PKAMAVXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  300
XXXXXXXTVG CSGRRSRTSW RATAPSGGSG XXXXXXXXXX XXXXGCDGFK VREEKGNFFL  360
CWQDRALFSV SAWRGRRFD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-158622475220GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032590.0AP003259.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0466H10.
GenBankAK2875400.0AK287540.1 Oryza sativa Japonica Group cDNA, clone: J065011K01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971220.11e-122PREDICTED: scarecrow-like protein 3
TrEMBLJ3L7T41e-176J3L7T4_ORYBR; Uncharacterized protein
STRINGOB01G52900.11e-175(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.19e-53scarecrow-like 3