PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G51240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 340aa    MW: 38558.9 Da    PI: 6.5094
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G51240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP99.46.6e-3180134357
           TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakp 57 
                   +k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++t++WLlqqa+ 
  OB01G51240.1  80 PKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETVQWLLQQAEX 134
                   6999*************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-2584134IPR005333Transcription factor, TCP
PROSITE profilePS5136923.15385139IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MDPKFPPPPP LNKTEPTTTA TTVTATNQHQ HQHQQQLDPK QYQQEEQRRR LQIEVQEQQD  60
GGAGKEQQVV GERRVQGLGP KRSSNKDRHT KVDGRGRRIR MPALCAARIF QLTRELGHKS  120
DGETVQWLLQ QAEXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  240
XXXXXXXXXX XXXGGGHIGF APMFAGHAAA AMPGLELGLS QDGHIGVLAA QSLSQFYHQV  300
GGAGASGQLQ HPHQHHQHQQ QQEDGEDDRD DGESDEESGQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G51240.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126093e-77CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLJ3L7B81e-64J3L7B8_ORYBR; Uncharacterized protein
STRINGOB01G51240.12e-65(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.14e-32TCP family protein