PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G48740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 273aa    MW: 28243.8 Da    PI: 8.6578
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G48740.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97.2e-4340138199
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+v++i+ lq++l+ql+++la++
  OB01G48740.1  40 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPYQREDAVNSLAYEADMRLRDPVYGCVAIISILQRNLRQLQQDLARA 136
                   7*********************************************************************************************998 PP

        DUF260  98 ke 99 
                   k 
  OB01G48740.1 137 KY 138
                   76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.39839140IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4240136IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MASSSASSVP APSGSVITIA SASAAAAAAA NAATCGTGSP CAACKFLRRK CQPDCVFAPY  60
FPPDNPQKFV HVHRVFGASN VTKLLNELHP YQREDAVNSL AYEADMRLRD PVYGCVAIIS  120
ILQRNLRQLQ QDLARAKYEL SKYQAAAAAA AAAAASPPGR RXXXXXXXXX XXXXXXXXXX  180
XXXXXSAALA SVGGGAAACF GPDQSFSAVQ MLSRSYEGEP MARFGGGNGG YEFGYSTSMA  240
GAGHMSSGLG TLGGGPFLKS GIAGSDERPG AGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-53341435114LOB family transfactor Ramosa2.1
5ly0_B2e-53341435114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNegative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}.
UniProtNegative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G48740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2002370.0AB200237.1 Oryza sativa Japonica Group CRLL3 mRNA for LOB domain protein, complete cds.
GenBankAK0714070.0AK071407.1 Oryza sativa Japonica Group cDNA clone:J023089G14, full insert sequence.
GenBankAK1195750.0AK119575.1 Oryza sativa Japonica Group cDNA clone:002-117-B04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646551.11e-126PREDICTED: LOB domain-containing protein 6-like
SwissprotA2WXT01e-125LBD6_ORYSI; LOB domain-containing protein 6
SwissprotQ8LQH41e-125LBD6_ORYSJ; LOB domain-containing protein 6
TrEMBLJ3L6L81e-174J3L6L8_ORYBR; Uncharacterized protein
STRINGOB01G48740.11e-175(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-55LBD family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]