PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G48180.1
Common NameLOC102720378
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 556aa    MW: 61990.6 Da    PI: 4.5531
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G48180.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS428.36.1e-1311875562374
          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                   ++lL++cA+a+s+ +  +aqa+++ l++++s +gdp qR+aay++e+Laar++ s++++ykal+++e++   +  +l+a+++++e++P+++f++++a
  OB01G48180.1 187 KQLLFDCATALSEYNVDEAQAIITDLRQMVSIQGDPSQRIAAYMVEGLAARIVASGTGIYKALTCKEAP---TLYQLSAMQILFEICPCFRFGFMAA 280
                   589*****************************************************************9...89999******************** PP

          GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                   N aIlea +ge+r+HiiDfdi+qG Q+++L+q L + +++p +lRiTgv++pe++      l+ +g+rL+k+Ae +gv+fef++ v  ++ d+++ +
  OB01G48180.1 281 NYAILEACKGEDRLHIIDFDINQGSQYITLIQFLKNNANKPRHLRITGVDDPETVqrTVGGLKVIGQRLEKLAEDCGVSFEFRA-VGANIGDVTPAM 376
                   *****************************************************99778889***********************.799********* PP

          GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                   L++++gEal+Vn+++qlh+l+desvs+ +erd++L++vk+l+Pk+v++veq+a++n+++F  rf e+ +yy+alfdsl+a+lpres +r++vEr++l
  OB01G48180.1 377 LDCRSGEALVVNFAFQLHHLPDESVSIMNERDQLLRMVKGLQPKLVTLVEQDANTNTAPFQIRFRETYDYYAALFDSLDATLPRESPDRMNVERQCL 473
                   ************************************************************************************************* PP

          GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   +reivn++aceg +r+er e ++kWr+r+++aGF+p p+s+++   +++ll+ + ++ y+ ee++g l +gW +++L++ SaWr
  OB01G48180.1 474 AREIVNILACEGPDRVERYEVAGKWRARMTMAGFTPCPFSSSVIGGIRSLLKSYCDR-YKFEEDNGGLHFGWGEKTLIVSSAWR 556
                   *******************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.045160537IPR005202Transcription factor GRAS
PfamPF035142.1E-128187556IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MSFVRRADPS TTYADNLYIH KFGPPNSNFA ARRYASDTQL FRYGPEPYNS DNSFYNQQAS  60
PIPYMVTADG HSPASADIQS NSCSDVAKDS PLVSNVSQQN SQSISDNQSS ELEVEFDEDE  120
IRMKLQELEH ALLDDSDDIL YEISQAGSIN DEWADPMKNA VLPNSPKESE SSISCAGSNN  180
GEPRTPKQLL FDCATALSEY NVDEAQAIIT DLRQMVSIQG DPSQRIAAYM VEGLAARIVA  240
SGTGIYKALT CKEAPTLYQL SAMQILFEIC PCFRFGFMAA NYAILEACKG EDRLHIIDFD  300
INQGSQYITL IQFLKNNANK PRHLRITGVD DPETVQRTVG GLKVIGQRLE KLAEDCGVSF  360
EFRAVGANIG DVTPAMLDCR SGEALVVNFA FQLHHLPDES VSIMNERDQL LRMVKGLQPK  420
LVTLVEQDAN TNTAPFQIRF RETYDYYAAL FDSLDATLPR ESPDRMNVER QCLAREIVNI  480
LACEGPDRVE RYEVAGKWRA RMTMAGFTPC PFSSSVIGGI RSLLKSYCDR YKFEEDNGGL  540
HFGWGEKTLI VSSAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-531885566375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0674570.0AK067457.1 Oryza sativa Japonica Group cDNA clone:J013106L10, full insert sequence.
GenBankAK0608330.0AK060833.1 Oryza sativa Japonica Group cDNA clone:001-034-C07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006645126.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLJ3L6G20.0J3L6G2_ORYBR; Uncharacterized protein
STRINGOB01G48180.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1