PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G44510.1
Common NameLOC102712589
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 561aa    MW: 59756.1 Da    PI: 7.2503
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G44510.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.11.8e-33218275260
                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                   dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  OB01G44510.1 218 DDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGTHNHPK 275
                   8****************************************.***************85 PP

2WRKY105.92.1e-33383441159
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   ldDgy+WrKYGqK+vkg+++prsYY+Ct+agCpv+k+ver+++d ++v++tYeg+Hnh+
  OB01G44510.1 383 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTAGCPVRKHVERASHDLRAVITTYEGKHNHD 441
                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-28210276IPR003657WRKY domain
PROSITE profilePS5081124.007212276IPR003657WRKY domain
SuperFamilySSF1182909.68E-26213276IPR003657WRKY domain
SMARTSM007741.4E-36217275IPR003657WRKY domain
PfamPF031068.6E-26218274IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-37368443IPR003657WRKY domain
SuperFamilySSF1182901.96E-29375443IPR003657WRKY domain
PROSITE profilePS5081138.687378443IPR003657WRKY domain
SMARTSM007741.2E-38383442IPR003657WRKY domain
PfamPF031069.4E-26384441IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MTTSSSGSIE TSANSRPGPY SFAGTSFTDL LGGNAVAGGG ASRYKAMTPP SLPLSPPPVS  60
PSSFFNSPIG MNQADFLGSP VLLTSSIFPS PTTGAFASQH FDWRPEVAAQ SADQGGKHEQ  120
RTSYSDFSFQ TAPASEEAAR TTTFQPPVPP APLGNEAYRG HQQQQPWGYQ QQPAGMDAGA  180
NTASFGAAPF QTTSSEMAPQ VQGGGGYSQP QSQRRSSDDG YNWRKYGQKQ VKGSENPRSY  240
YKCTYPNCPT KKKVERSLDG QITEIVYKGT HNHPKPQNTR RSSGSAAAQV LQSGGDMSEH  300
SFGGMSGTAA TPENSSASFG DDEIGVGSPR AGNNAGGDEF DDDEPDSKRW RKDGDGEGIS  360
MAGNRTVREP RVVVQTMSDI DILDDGYRWR KYGQKVVKGN PNPRSYYKCT TAGCPVRKHV  420
ERASHDLRAV ITTYEGKHNH DVPAARGSAA LSRPAPPVAA ASHQYLPNQP TVSYQSGAAG  480
PQSYALRPDG FGAQGGSFVL GGGAAPLQDG GSSFGGFSGF DDARGSYMSQ HHQQQRQHDA  540
MHASRAKEEP GDDMFFQNSL Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-36209444878Probable WRKY transcription factor 4
2lex_A6e-36209444878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G44510.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6769250.0AY676925.1 Oryza sativa (indica cultivar-group) transcription factor WRKY24 (WRKY24) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644934.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ6B6R40.0WRK24_ORYSI; WRKY transcription factor WRKY24
TrEMBLJ3L5E50.0J3L5E5_ORYBR; Uncharacterized protein
STRINGOB01G44510.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29923687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-100WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]