PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G44400.1
Common NameLOC102711753
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 249aa    MW: 26183.7 Da    PI: 6.7867
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G44400.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.85.6e-41611601100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vhk+FGasnv+k+l +++e er da+sslvyeA+ r+rdPvyG++g i+ lqqq++ l+ael+++
  OB01G44400.1  61 PCAACKLLRRRCAQECPFAPYFSPHEPHKFAAVHKVFGASNVSKMLLEVSEAERADAASSLVYEANLRLRDPVYGCMGAISMLQQQVNALEAELEAV 157
                   7**********************************************************************************************99 PP

        DUF260  98 kee 100
                   ++e
  OB01G44400.1 158 RTE 160
                   987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.1080.105.8E-453179No hitNo description
PROSITE profilePS5089125.27460161IPR004883Lateral organ boundaries, LOB
PfamPF031955.8E-4161158IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MSTERERLDE VGKKIKREPD TSGVVVAAAA ATGTATATGA PIEHRVPHRL GLGGAVNTVT  60
PCAACKLLRR RCAQECPFAP YFSPHEPHKF AAVHKVFGAS NVSKMLLEVS EAERADAASS  120
LVYEANLRLR DPVYGCMGAI SMLQQQVNAL EAELEAVRTE IFKHRYRQAG AGVPGLMDDV  180
HAAAVFPSPA PPPIHARDVV SVVEAGGQEL TGAPVISAAA SPPVYAAGQP SSTTDYGSLN  240
TSEHAAYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-426118211131LOB family transfactor Ramosa2.1
5ly0_B2e-426118211131LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G44400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1219190.0AK121919.1 Oryza sativa Japonica Group cDNA clone:J033106D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644931.10.0PREDICTED: LOB domain-containing protein 15 isoform X1
SwissprotQ8L5T58e-67LBD15_ARATH; LOB domain-containing protein 15
SwissprotQ9AT612e-66LBD13_ARATH; LOB domain-containing protein 13
TrEMBLJ3L5D40.0J3L5D4_ORYBR; Uncharacterized protein
STRINGOB01G44400.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.17e-69LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]
  2. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]