PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G43630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 401aa    MW: 43087.4 Da    PI: 9.9288
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G43630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.32.1e-15331378553
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                   +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN +Lk + +el 
  OB01G43630.1 331 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENGRLK-RQKELD 378
                   79***************************************9.444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.0E-14326374No hitNo description
SMARTSM003381.6E-11327399IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.427329374IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.31E-11331376No hitNo description
CDDcd147071.35E-24331387No hitNo description
PfamPF001709.9E-13331374IPR004827Basic-leucine zipper domain
PROSITE patternPS000360334349IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MAPLLQLFSS FPHKYSCSAL FSKVQTFSLQ QNDYKNKLFS GSLPRGGSPA QAVGPVGSWG  60
ARQWRLRPEA GAGGIAAGAA AQRGQMQMQG LGRQGSLCSL TLDEVQSHLG EPLHSMNLDE  120
LLRSVFSDGV AAADGATTSQ RHEPGSGLLR QGSIAMPPEL SKKTVDEVWK GIQAAPKRNA  180
EAGGGRRRRE RQPTLGEVTL EDFLVKAGVV TQGSLKDLGD AGNVVDPVGR AAAATGAVDL  240
ASGAQWMDQY NQQIASADAH HHGQQSVQGS YMSNRLVPQP LNVGLGPGAI LESSYSDGQT  300
SSGMIGGISD SQTPGRKRGM SGDVADKLME RRQKRMIKNR ESAARSRARK QAYTNELENK  360
VSRLEEENGR LKRQKELDEL LCAVPVPEPK YQLRRTNSAD F
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1184191GRRRRERQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0043310.0AP004331.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OSJNBa0085D07.
GenBankAP0035700.0AP003570.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0432B10.
GenBankAP0032470.0AP003247.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0425G02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627754.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES35e-81AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLJ3L5570.0J3L557_ORYBR; Uncharacterized protein
STRINGOB01G43630.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.14e-74ABA-responsive element binding protein 3