PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G42980.1
Common NameLOC102712588
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 224aa    MW: 24969.3 Da    PI: 6.624
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G42980.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.97e-1170119150
                   XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                   e++l+++r+   NReA r++R++Kka  + Lee+vk+L + N++L  +l+
  OB01G42980.1  70 EEDLRKTRKPLGNREAVRKYREKKKAHAAFLEEEVKKLRTTNQQLLRRLQ 119
                   789******************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-1270137IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.6E-1570138No hitNo description
PfamPF077164.3E-1272119IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.03672119IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.31E-873120No hitNo description
CDDcd146862.00E-1175128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MDEEVHLPIP SHLLFSHPEI SHGFDEILKN TTTCTHSHTC NPPGPSVAMH THTCLHTHIQ  60
VLASGENNVE EDLRKTRKPL GNREAVRKYR EKKKAHAAFL EEEVKKLRTT NQQLLRRLQG  120
HISLEAEVVR LRALLFDIRG KIDAEIGTFP FQKQCSFGSV TCTDHSPRIN TGAEVAVREE  180
SSRPTIVDCG IDETGIVSHE LEIPGMANTV DVIPSFLSTA SLTE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAP0032210.0AP003221.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0003D09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644854.11e-165PREDICTED: uncharacterized protein LOC102712588
RefseqXP_015699287.11e-165PREDICTED: uncharacterized protein LOC102712588
RefseqXP_015699288.11e-165PREDICTED: uncharacterized protein LOC102712588
SwissprotQ8GTS23e-51BZP23_ARATH; Basic leucine zipper 23
TrEMBLJ3L4Z21e-165J3L4Z2_ORYBR; Uncharacterized protein
STRINGOB01G42980.11e-165(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.12e-32bZIP family protein