PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G40150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 634aa    MW: 69211.9 Da    PI: 8.5754
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G40150.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B379.24.4e-2594195199
                   EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
            B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                   f+k+lt sd++++g +++p++ ae++       ++    s++l+ +d++g +W++++iyr++++r++lt+GW++Fv+ ++L +gD v+F   + +++
  OB01G40150.1  94 FCKTLTASDTSTHGGFSVPRRAAEDCfppldhkQLR--PSQELVAKDLHGTKWRFRHIYRGQPRRHLLTTGWSSFVNKKKLVSGDAVLFL--RGDDG 186
                   99**************************99865444..4669************************************************..34899 PP

                   ..EEEEE-S CS
            B3  91 elvvkvfrk 99 
                   el+++v+r+
  OB01G40150.1 187 ELRLGVRRA 195
                   99****997 PP

2Auxin_resp1081e-35220299182
    Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                   +a++++++svF+++YnPr s+seF+v+++k++k+++++v++GmRfk++fe+ed++er+ +G+++gvs++dp+rWp+SkW+sL
  OB01G40150.1 220 VAESLKHGSVFHICYNPR-SASEFIVPYWKFMKSFNHPVCIGMRFKFQFESEDVNERH-AGMIAGVSEVDPIRWPGSKWQSL 299
                   67899*************.69***********************************99.9********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-4678233IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.9E-3992197IPR015300DNA-binding pseudobarrel domain
CDDcd100173.13E-2392194No hitNo description
PROSITE profilePS5086313.56394196IPR003340B3 DNA binding domain
SMARTSM010194.3E-2494196IPR003340B3 DNA binding domain
PfamPF023624.3E-2394195IPR003340B3 DNA binding domain
PfamPF065072.0E-29221299IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MTVSTGSASW LTLATRQGPT QTSVIGQSPR TTRSGGRRSL LRTADAATDE VYARLALVAE  60
GEVFERNSHG GGSQREDDME DGDEERKSGM LHMFCKTLTA SDTSTHGGFS VPRRAAEDCF  120
PPLDHKQLRP SQELVAKDLH GTKWRFRHIY RGQPRRHLLT TGWSSFVNKK KLVSGDAVLF  180
LRGDDGELRL GVRRATQLKN EALFKAFSSD SSKMRTLLSV AESLKHGSVF HICYNPRSAS  240
EFIVPYWKFM KSFNHPVCIG MRFKFQFESE DVNERHAGMI AGVSEVDPIR WPGSKWQSLL  300
VRWEGATDCN SQNRVSPWDI EIVGGSVSVA QSVSASSSKR TKLCPQGNLD TPSLYGNGRP  360
DSVETEKFPR VLQGQELMGS RTHRVTCSPQ PIDITKSKSF DAWRFLTDTR SCMLGSSTSR  420
LPVSCSGFTQ QSVGFSESIG FPEVLQGQES SQGVPPLQGM MPDAYSAKSR HELKNHMYTP  480
AAMSGLSAAN QGYCLSLLST GPPSPPSSLV LYQTGVPQLE LASKNKDKSG NGSQPALPLH  540
KLPGETCWEQ LEIGNASTPG NAAKSGHGGR EVGRTSCRLF GFSLTEKIVP TDKGGEKEGN  600
YEADCQNPRM LDLFGYNCTT SGALHALCAA PLGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A2e-783932179353Auxin response factor 1
4ldy_B2e-783932179353Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G40150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0723300.0AK072330.1 Oryza sativa Japonica Group cDNA clone:J023039P13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646331.20.0PREDICTED: auxin response factor 3, partial
SwissprotQ5JMM10.0ARFC_ORYSJ; Auxin response factor 3
TrEMBLJ3L4590.0J3L459_ORYBR; Auxin response factor
STRINGOB01G40150.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51132756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-117ARF family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Song X, et al.
    Rice RNA-dependent RNA polymerase 6 acts in small RNA biogenesis and spikelet development.
    Plant J., 2012. 71(3): p. 378-89
    [PMID:22443269]