PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G40080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family VOZ
Protein Properties Length: 611aa    MW: 67547.2 Da    PI: 6.9296
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G40080.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ428.97.4e-1323125291217
           VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                   p+p+afl+pkcalwdc+rpaqgse++qdycs++ha+la++e g+pgt+pv+rp+gidlkdg+lfaalsak+qgk+vgip+cegaatakspwna+elf
  OB01G40080.1 312 PAPAAFLRPKCALWDCPRPAQGSERWQDYCSMYHADLAVKEeGPPGTMPVIRPRGIDLKDGPLFAALSAKIQGKHVGIPVCEGAATAKSPWNAPELF 408
                   89*************************************9879****************************************************** PP

           VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdek 193
                   dl ++ege+irewlffdkprrafesgnrkqrslpdy+grgwhesrkqvmk+fgglkrsyymdpqpsss+ewhlyeyein++da+alyrle+k++d+k
  OB01G40080.1 409 DLYIFEGESIREWLFFDKPRRAFESGNRKQRSLPDYTGRGWHESRKQVMKDFGGLKRSYYMDPQPSSSYEWHLYEYEINDCDAFALYRLEFKSSDAK 505
                   ************************************************************************************************* PP

           VOZ 194 ksakgkvskdsladlqkklgrlta 217
                   k+ak+k+++++l+++q++++rl+a
  OB01G40080.1 506 KTAKSKLACNPLNEIQQQMVRLSA 529
                   **********************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MGRGPAAARP SSGTARHQQF RARAKTRVDD LQEMFSGLQS ARKESRSTDA AVLEAQLHQM  60
LREWRAELSV PSPASSLQAR APLNFFPASP PPLTISGLLG SRFHWVAVGG QDMKPEPREE  120
AVASPADLTV PQSPSQGVIA SGGGMLAPAA AAVFHDQGCL DIAAICHSQV VNVLVTSFPP  180
VTFAAAIVEQ LCPTFHVSRT CIGGGSSWRF VRLGKNMSMG IVMVVSRTKQ MYYVNQELTV  240
EDFLYDDNYK MYLPGSNPDV LSNLEGTGQL EYPQFNLPQE LPPNTYLDMS NCGQSAGDVF  300
LHMSDLLTTM SPAPAAFLRP KCALWDCPRP AQGSERWQDY CSMYHADLAV KEEGPPGTMP  360
VIRPRGIDLK DGPLFAALSA KIQGKHVGIP VCEGAATAKS PWNAPELFDL YIFEGESIRE  420
WLFFDKPRRA FESGNRKQRS LPDYTGRGWH ESRKQVMKDF GGLKRSYYMD PQPSSSYEWH  480
LYEYEINDCD AFALYRLEFK SSDAKKTAKS KLACNPLNEI QQQMVRLSAD SPVENKRSAR  540
SRTKANPNDI NSNIYSVQNT TAQGGIPNAY QAVSQVDQMT YLNGNVVYGP HLPYGYSTER  600
SDFYWSSNDG A
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G40080.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2417650.0AK241765.1 Oryza sativa Japonica Group cDNA, clone: J065205E23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025818470.10.0transcription factor VOZ1-like
SwissprotQ9SGQ01e-123VOZ1_ARATH; Transcription factor VOZ1
TrEMBLJ3L4520.0J3L452_ORYBR; Uncharacterized protein
STRINGOB01G40080.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-119vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]