PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G38850.1
Common NameLOC102702435
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 261aa    MW: 28258.8 Da    PI: 7.2229
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G38850.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.41.2e-32182240159
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   ldDgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+v+r a+d+++v++tYeg Hnh+
  OB01G38850.1 182 LDDGYRWRKYGQKAVKNSKHPRSYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGVHNHP 240
                   59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-33168240IPR003657WRKY domain
SuperFamilySSF1182909.55E-29174241IPR003657WRKY domain
PROSITE profilePS5081128.885177242IPR003657WRKY domain
SMARTSM007741.1E-38182241IPR003657WRKY domain
PfamPF031064.5E-26183240IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MEHLHGDDAH HEAGHAAATI PHFPYFPVPL TPPPLAEPAA STTSGERHGA PLEALQPPPP  60
CSHPGGLDGG TPDDHQLMTT TALPMMLPAM TALDWQSLLQ TCLQVVPPEA APELQQAGAA  120
AQADQCSGEN DHGDQQLAAE SGGGACSNKE KQLAKGGAGR SGKKKASRPR FAFQTRSDND  180
ILDDGYRWRK YGQKAVKNSK HPRSYYRCTH HTCNVKKQVQ RLAKDTSIVV TTYEGVHNHP  240
CEKLMEALTP ILKQLQFLSQ F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-24172239774Probable WRKY transcription factor 4
2lex_A7e-24172239774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00539DAPTransfer from AT5G41570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G38850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1089090.0AK108909.1 Oryza sativa Japonica Group cDNA clone:002-152-G06, full insert sequence.
GenBankAY3418450.0AY341845.1 Oryza sativa (japonica cultivar-group) WRKY4 mRNA, complete cds.
GenBankAY8706070.0AY870607.1 Oryza sativa (japonica cultivar-group) WRKY23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646294.10.0PREDICTED: probable WRKY transcription factor 56
TrEMBLJ3L3S90.0J3L3S9_ORYBR; Uncharacterized protein
STRINGOB01G38850.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110038133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41570.15e-56WRKY DNA-binding protein 24