PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G33230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 155aa    MW: 16460.2 Da    PI: 9.556
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G33230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP61.52e-19109155248
                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                   C v+g ++dls+ ++yhrrhkvCe hsk p v+v+ +e rfCqqCsr
  OB01G33230.1 109 CTVDGRKEDLSKHRDYHRRHKVCEGHSKIPLVIVASREMRFCQQCSR 155
                   **********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.9E-20101155IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.648106155IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.41E-18107155IPR004333Transcription factor, SBP-box
PfamPF031101.8E-14109155IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MQAWLVLCLC VVLSATDEFS VILIDFGTVL LLSPFLRLGL LCLVDLKLGG LGEFGGDGGA  60
QTRVMAGVGG GSRGVEAKGK GPAAASAPAK RLRVSGGGGV GQQQQRPSCT VDGRKEDLSK  120
HRDYHRRHKV CEGHSKIPLV IVASREMRFC QQCSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4184611e-56HQ418461.1 Oryza sativa Japonica Group cultivar TNG67 x TK2 SLP16 (SPL16) gene, SPL16-Slp1 allele, complete cds.
GenBankAP0149641e-56AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0055291e-56AP005529.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0702E04.
GenBankJX8671191e-56JX867119.1 Oryza sativa Indica Group cultivar Amol3 truncated squamosa promoter binding protein-like 16 (SPL16) gene, SPL16-gw8 allele, complete cds.
GenBankJX8671181e-56JX867118.1 Oryza sativa Indica Group cultivar Basmai385 squamosa promoter binding protein-like 16 (SPL16) gene, SPL16-gw8 allele, complete cds.
GenBankJX8671171e-56JX867117.1 Oryza sativa Indica Group cultivar Huajingxian74 squamosa promoter binding protein-like 16 (SPL16) gene, SPL16-GW8 allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460490.13e-26hypothetical protein SORBIDRAFT_02g029300
SwissprotQ0J0K14e-27SPL18_ORYSJ; Squamosa promoter-binding-like protein 18
TrEMBLJ3L2671e-108J3L267_ORYBR; Uncharacterized protein
STRINGOB01G33230.11e-107(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76580.12e-16SBP family protein