PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G19360.1
Common NameLOC102714684
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 296aa    MW: 31654.6 Da    PI: 7.3422
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G19360.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK72.36.2e-233581450
        RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50
                  ++s e++sk Fslpi++AA+ Lgvc++vLKriCR +GI RWP+Rk+ 
  OB01G19360.1 35 SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRSHGIVRWPYRKLV 81
                  6899*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.97214103IPR003035RWP-RK domain
PfamPF020424.7E-213681IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MCAAPMASGA QPQQPAALQQ QQEEEAQAQK PTRVSLSYEE ISKLFSLPIA EAASILGVCT  60
SVLKRICRSH GIVRWPYRKL VSGKSGDDTK SAEREKAKEL LEISRLAKQK ALSASGLSTV  120
SPGTFQGVAK SQQGSSKAGQ VSPPGKQNAL SGSGILAHGT QTKAIPTYMD DFKHGFPSCG  180
LSWETMKWWG TDSHTETTPA KDENGEAPES ANEASKGMTD DDELDWGADE AEAEAITTEP  240
SAQLCTLRRK AVDDGRKLLT GKTCGSLELC RLNKRQKMAL AQVFGASLPE QSSRLG
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G19360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006643988.10.0PREDICTED: protein NLP2-like
TrEMBLJ3KY800.0J3KY80_ORYBR; Uncharacterized protein
STRINGOB01G19360.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67053242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.12e-10RWP-RK domain-containing protein