PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G19140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 104aa    MW: 10841.5 Da    PI: 9.617
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G19140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26049.51.2e-151050141
        DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasn 41
                  aCa+Ck++rrkC+++C la yfpa+++++f+++h +FG + 
  OB01G19140.1 10 ACAVCKHQRRKCEPNCELAAYFPANRMNDFRALHLVFGGAA 50
                  7************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.3559104IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-131051IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MTGGGSGAGA CAVCKHQRRK CEPNCELAAY FPANRMNDFR ALHLVFGGAA AAAAVAPQCR  60
GPAQLSEGRV TLGTRATRGD MPTANGLWVK ALVRSSASEM NFMV
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G19140.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1087245e-64AK108724.1 Oryza sativa Japonica Group cDNA clone:002-150-C08, full insert sequence.
GenBankAP0032015e-64AP003201.3 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1066G12.
GenBankAP0149575e-64AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126095e-64CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLJ3KY585e-70J3KY58_ORYBR; Uncharacterized protein
STRINGOB01G19140.18e-71(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP130442833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-09LOB domain-containing protein 2