PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G18870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 751aa    MW: 82377.2 Da    PI: 6.5016
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G18870.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK919.1e-29404455152
        RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   aek+isl++l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  OB01G18870.1 404 AEKTISLDVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 455
                   589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.541394475IPR003035RWP-RK domain
PfamPF020425.0E-26407455IPR003035RWP-RK domain
SuperFamilySSF542773.14E-21646742No hitNo description
Gene3DG3DSA:3.10.20.2402.2E-25657738No hitNo description
PROSITE profilePS5174519.362657739IPR000270PB1 domain
PfamPF005646.1E-16657738IPR000270PB1 domain
SMARTSM006667.2E-25657739IPR000270PB1 domain
CDDcd064073.57E-34658738No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MMYMFSVDGE NAGELGLPGR VYKQKVPEWT PNVQYYSSTE YPRLNHAISY NVHGTVALPV  60
FDPSIQSCIA VVELIMTSKK INYACEVDKV CKALEAVNLK STEILDHPNV QICNEGRQSA  120
LVEILEILTV VCEDHKLPLA QTWVPCKYRS VLAHGGGVKK SCLSFDGSCM GEVCMSTSDV  180
AFHVIDAHMW GFRDACVEHH LQKGQGVAGK AFIYHRPCFS KDISQFCKLE YPLVHYAKMF  240
GLAGCFAICL QSLYTGDDDY ILEFFLPPNC RNKDDQNALL ESILARMKKC LRSLKVVGNG  300
DSNEVCLQIS NVLIIENEDL KTNVHFENSE GCFRELPEGN ASHRVHEVDN GDNKVSTMSE  360
RHLQADDNSQ NNGASAGRPN GSGASDSSLL HKSNKPPERR RGKAEKTISL DVLQQYFSGS  420
LKNAAKSLGV CPTTMKRICR QHGISRWPSR KINKVNRSLS KLKQVIESVQ GSDAAFNLTS  480
ITGPLPIPVG PSSDSQNIEK ASPNKVAELS NLAVEGDRDS SFQKPQENDG NLAILMSQQG  540
FIDANNNLQL EADKASQSRS SSGEGSINSR TSEASCQGSP ANQTFVCKSI ASTFTEPQLI  600
PEGFTKEPFQ EPALPLSKML IEDSGSSKDL KNLFTSAVDQ PILSRSSNLA QMQNSGTVTI  660
KASFKEDIVR FRFPCSGSVT ALKDEVAKRL RMDVGMFDIK YLDDDHEWVK LACNADLEEC  720
MEISRNSGSH VIRLLVSDVA AHLGSSCGSS G
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G18870.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0673190.0AK067319.1 Oryza sativa Japonica Group cDNA clone:J013106K21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006643969.20.0PREDICTED: protein NLP3, partial
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLJ3KY310.0J3KY31_ORYBR; Uncharacterized protein
STRINGOB01G18870.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7