PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G18840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 639aa    MW: 71041.2 Da    PI: 6.5566
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G18840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.91.4e-2160160198
                   EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
            B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                   f+k+ltpsd++++g +++ +++a+e+       +     +++l+ +d++  +W++k+iyr++++r++lt+GW+ Fv +++L +gD +v    +++++
  OB01G18840.1  60 FCKILTPSDTSTHGGFSVLRRHANEClppldmsMAT--PTQELITKDLHRSEWRFKHIYRGQPRRHLLTTGWSTFVTSKKLISGDAFVYL--RSETG 152
                   99****************************974333..3458999******************************************999..44788 PP

                   ..EEEEE- CS
            B3  91 elvvkvfr 98 
                   e +v+v+r
  OB01G18840.1 153 EQHVGVRR 160
                   88***998 PP

2Auxin_resp996.8e-33186267183
    Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                   a+ha++t+s+F v+Y+Pr s+s+++v+v+k+++a k+ + vGmRfkm+fe+ed++ +++sGt+vg  dl+p +W++S+W+sLk
  OB01G18840.1 186 ASHAIKTNSIFLVYYRPRLSQSQYIVSVNKYLAASKIGFNVGMRFKMSFEGEDVPVKKFSGTIVGEGDLSP-QWSGSEWKSLK 267
                   789********************************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-3655189IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.0E-3555175IPR015300DNA-binding pseudobarrel domain
CDDcd100175.49E-1658160No hitNo description
SMARTSM010193.6E-1660162IPR003340B3 DNA binding domain
PfamPF023626.9E-1960160IPR003340B3 DNA binding domain
PROSITE profilePS5086310.41960162IPR003340B3 DNA binding domain
PfamPF065074.8E-29186267IPR010525Auxin response factor
PfamPF023093.0E-5527571IPR033389AUX/IAA domain
SuperFamilySSF542771.83E-8530608No hitNo description
PROSITE profilePS5174523.646535624IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MFQVPYKILC KVVNVELKAE TETDEVFAQI TLLPDPDQEN LPTLPDPPLT AHRRPVVHSF  60
CKILTPSDTS THGGFSVLRR HANECLPPLD MSMATPTQEL ITKDLHRSEW RFKHIYRGQP  120
RRHLLTTGWS TFVTSKKLIS GDAFVYLRSE TGEQHVGVRR LVQKQSTMPA SVISSQSMHL  180
GVLASASHAI KTNSIFLVYY RPRLSQSQYI VSVNKYLAAS KIGFNVGMRF KMSFEGEDVP  240
VKKFSGTIVG EGDLSPQWSG SEWKSLKVQW DEVTNVNGPE RVSPWEIEIC DATAPAINVP  300
LQSSTKNKRL REPSETVDLQ SLEPAQEFWL SGMPQQHEKT GIGSSEPNCI SGHQVVWPGE  360
HPGYGAVSSS SVCQNPLVLE SWLKDFNSSS KGVSPTLSEI SQKLFQVTSN EARVATWPTR  420
SAHQAEEPTS KLSLNTAVCG YRTEEVAPNA SKVVEGKKEP SMFRLFGVDL MKCTSVSTTT  480
DSDKSSVGAG ETSTKGTGSH EDSGQLSAFS KVTKDHIAVD ESPREIQSHQ NYTGRTRIKV  540
QMHGNAVGRA VDLANLDGYG QLMNELEELF NIKDLKQKWK VAFTDDEGDT MEVGDDPWLE  600
FCQMVRKIVL YPIEDEKKIE PQPKLLPAAN QEQDHKTAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-131228867353Auxin response factor 1
4ldw_A1e-131228867353Auxin response factor 1
4ldw_B1e-131228867353Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G18840.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin under light or dark conditions. {ECO:0000269|PubMed:17408882}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0713000.0AB071300.1 Oryza sativa OsARF16 mRNA for auxin response factor 16, partial cds.
GenBankAK1025210.0AK102521.1 Oryza sativa Japonica Group cDNA clone:J033095P08, full insert sequence.
GenBankEU8470080.0EU847008.1 Oryza sativa Japonica Group clone KCS385B05 auxin response factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006645691.10.0PREDICTED: auxin response factor 1
SwissprotQ5NB850.0ARFA_ORYSJ; Auxin response factor 1
TrEMBLJ3KY280.0J3KY28_ORYBR; Auxin response factor
STRINGOB01G18840.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108236116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.31e-166auxin response factor 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]