PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G17130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 363aa    MW: 39496 Da    PI: 10.5392
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G17130.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.35.2e-11186230549
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                   kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++
  OB01G17130.1 186 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRV 230
                   8999*********************************99998665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-14182246IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.76184240IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.8E-14186240No hitNo description
PfamPF001707.3E-10186236IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-11186240No hitNo description
CDDcd147034.61E-23187237No hitNo description
PROSITE patternPS000360189204IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MAQLPPKIPT MATAWPEFGG GHHHHAHGHH HQRSPSMGAF LAAPLPPFPP PPPAPANGGA  60
HQQQQQQPSW VDEFLDFSAA KRGAHRRSVS DSVAFLDPVA DDNAGVGAHD FDRLDDDQLM  120
SMFSDDLQPP PPQQQPAAPA ASASSPSDHN SMNDEKQDKG ETEEAQSECD GATPGQPASP  180
ATVDPKRVKR ILANRQSAQR SRVRKLQYIS ELERSVTSLQ TEVSALSPRV AFLDHQRSLL  240
TLGNSHLKQR IAALAQDKIF KDGGTEEGDR EAAANLPPAK PQERGIHTGR RGRPGPRQRQ  300
GRPDRQRGDR RARGLVIDRP RSGRAVCSEV ALASAPRQPR ALPRAGRRHV RFGALFGFAF  360
FGV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1009440.0AK100944.1 Oryza sativa Japonica Group cDNA clone:J023138F18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694867.11e-139PREDICTED: basic leucine zipper 2-like
SwissprotQ5QNI51e-150BZP02_ORYSJ; Basic leucine zipper 2
TrEMBLJ3KXK70.0J3KXK7_ORYBR; Uncharacterized protein
STRINGOB01G17130.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-75bZIP family protein