PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G14760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 551aa    MW: 59470.4 Da    PI: 10.0588
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G14760.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.11.5e-31282337156
       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                   k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  OB01G14760.1 282 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 337
                   68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.554279339IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.0E-28280340IPR009057Homeodomain-like
SuperFamilySSF466894.66E-17280340IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-26282337IPR006447Myb domain, plants
PfamPF002491.2E-6284335IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MASSSSDLTL DYKPNGDCGA YPGQAAAATA AAALVIDHHL TATGQATQKL QEFLSRLEEE  60
RLKIDAFKRE LPLCMQLLNH AMEAYRQQLE AYQMGSQQAA AAAVARPLVL EEFIPIKNIG  120
IDVAASAADK AAGGNVSSEK ASWMVSAQRW NAPAADAAPA KGPQTPKEHH PLDTSPKLSA  180
LDGGGGACQR GGGAFLPFSK DSALADGSAA AALPELALAP AEKDTITVAA AEVDKKLYVH  240
DVNGSNNGAA GRPREAQNGG EPSSTAPDGG QAVPPQPQPH RKARRCWSPE LHRRFVNALQ  300
ILGGAQVATP KQIRELMKVD GLTNDEVKSH LQKYRLHTRR PMPAPAPPTA ATPQLVVLGG  360
IWVPPEYATQ AAGPAIYGGH PATXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  420
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  480
XXXXXXXAGT GPRASTRRAR EIRTARTTTT TTTTRWRRRP PPTAPSTPPP TTRSPPPPAN  540
TKLLINKPSR A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-13282335255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-13282335255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-13282335154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13282335154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13282335154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13282335154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-13282335255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-13282335255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-13282335255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-13282335255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-13282335255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-13282335255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G14760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1098081e-169AK109808.1 Oryza sativa Japonica Group cDNA clone:002-147-G07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015695763.10.0PREDICTED: uncharacterized protein LOC102711030
SwissprotQ5VRW21e-171NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLJ3KWX00.0J3KWX0_ORYBR; Uncharacterized protein
STRINGOB01G14760.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.16e-74G2-like family protein
Publications ? help Back to Top
  1. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]