PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G14220.1
Common NameLOC102706228
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family LBD
Protein Properties Length: 248aa    MW: 25483.8 Da    PI: 7.7814
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G14220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.72.3e-44301291100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasnv+kll++l +++reda+ssl+yeAear++dPvyG+vg i+ lq+q+++l++el+++
  OB01G14220.1  30 PCAACKFLRRKCLPGCVFAPYFPPEEPQKFANVHKVFGASNVTKLLNELLPHQREDAVSSLAYEAEARVKDPVYGCVGAISVLQRQVHRLQKELDAA 126
                   7**********************************************************************************************99 PP

        DUF260  98 kee 100
                   ++e
  OB01G14220.1 127 HAE 129
                   987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.50329130IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4330127IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MASSSSTNNS AISTVVASGA ATTTPGAGSP CAACKFLRRK CLPGCVFAPY FPPEEPQKFA  60
NVHKVFGASN VTKLLNELLP HQREDAVSSL AYEAEARVKD PVYGCVGAIS VLQRQVHRLQ  120
KELDAAHAEL LRYACGEVGI PTALPVTAAP RLAAAMPAPG QLAAVSAGMY GSRRLGVVDG  180
GGIAPPSPHA GCYYARNNNA GSIGADVAPV LPYASVANWT VNAISTTTTN SGSESIGMDH  240
KEGGDSSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-85201491131LOB family transfactor Ramosa2.1
5ly0_B2e-85201491131LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB01G14220.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2002380.0AB200238.1 Oryza sativa Japonica Group CRLL4 mRNA for LOB domain protein, complete cds.
GenBankAK1055270.0AK105527.1 Oryza sativa Japonica Group cDNA clone:001-127-G05, full insert sequence.
GenBankAP0029120.0AP002912.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0028E10.
GenBankAP0033390.0AP003339.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OJ1276_B06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006643801.20.0PREDICTED: protein LATERAL ORGAN BOUNDARIES-like isoform X1
RefseqXP_015698431.10.0PREDICTED: protein LATERAL ORGAN BOUNDARIES-like isoform X1
SwissprotQ9FML48e-69LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLJ3KWR60.0J3KWR6_ORYBR; Uncharacterized protein
STRINGOB01G14220.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88133545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-64LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]