PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB0102G10020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 441aa    MW: 48601.3 Da    PI: 7.8717
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB0102G10020.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY993e-31335391360
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     Dgy+WrKYGqK+vkgsefprsYY+Ct+++C+vk+kve +  d+++ ei+Y+geHnh+k
  OB0102G10020.1 335 DGYSWRKYGQKQVKGSEFPRSYYKCTHPTCSVKRKVEMTP-DGQIAEIVYNGEHNHPK 391
                     9***************************************.***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF540013.34E-3734224No hitNo description
PROSITE profilePS5060012.7442208IPR003653Ulp1 protease family, C-terminal catalytic domain
Gene3DG3DSA:3.30.310.1304.9E-5113202No hitNo description
Gene3DG3DSA:2.20.25.804.0E-27327392IPR003657WRKY domain
PROSITE profilePS5081122.527328392IPR003657WRKY domain
SuperFamilySSF1182902.48E-24329392IPR003657WRKY domain
SMARTSM007741.1E-33333391IPR003657WRKY domain
PfamPF031063.1E-24335390IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006508Biological Processproteolysis
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0019784Molecular FunctionNEDD8-specific protease activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MCMVIVVYIA VPQRGNYSRI GLKMRPRRAG GEEERVLSHG DVVLLRCDLT VLHGPHFLND  60
RIIAFYFAHL SSSLPARDDL LLLPPSIPYL LSNLPDPPSV AAVADPLRLA SRRLALFPVN  120
DNPDVSHAEG GSHWTLFVLD NTHPDSGPRF VHHDSLPPTN LLPARRLAAV LRPLLPASAR  180
IPLIEGPTPR QTNGYDCGVF VLAVARAICH WWATRHQEGE SDWFEAVKRE VNADGVKAMS  240
LQLHFLSCPS IASTSPCLQA VAAHETLVGY AKSQEGHCCE ACGIQAFFPI ELEDSGSTYD  300
QKKADTAKIT CQDNLTVSHS VRQPISSVKN RLSYDGYSWR KYGQKQVKGS EFPRSYYKCT  360
HPTCSVKRKV EMTPDGQIAE IVYNGEHNHP KPYPPKKPSL SSVETVVATN DAGLENQLEG  420
CDQAIGSNVV TEAFSGRKKR S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2bkq_A1e-23362195185SENTRIN-SPECIFIC PROTEASE 8
2bkq_B1e-23362195185SENTRIN-SPECIFIC PROTEASE 8
2bkq_C1e-23362195185SENTRIN-SPECIFIC PROTEASE 8
2bkq_D1e-23362195185SENTRIN-SPECIFIC PROTEASE 8
2bkr_A1e-23362195185SENTRIN-SPECIFIC PROTEASE 8
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapOB0102G10020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126201e-171CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015698188.10.0PREDICTED: uncharacterized protein LOC102718700
TrEMBLJ3KV230.0J3KV23_ORYBR; Uncharacterized protein
STRINGOB0102G10020.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23252941
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.24e-26WRKY family protein