PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART12G17540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 367aa    MW: 39544 Da    PI: 7.9635
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART12G17540.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.41.4e-2274118246
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
                      pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+h+
  OBART12G17540.1  74 PRMRWTTALHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHM 118
                      9*****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.9E-1972118IPR009057Homeodomain-like
SuperFamilySSF466891.79E-872117IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-1474117IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MAPDLSLHIS PPSPAPATEP RLELGLADDT AVAAAKTTTD DERRRRPHQP IQTAHGFKKS  60
SGSGGGGKRS ARAPRMRWTT ALHAHFVHAV ELLGGHERAT PKSVLELMNV KDLTLAHMYR  120
TVKGTDRSCV AGHGQASRKM GFLMRRGLVA EVDSFDGFNN NNMVNTTSNN TTSRKSQSPG  180
EQQLQDLQSG WPPHYLASSE SDHLLMEQRL MQEIWKGAAA AAAHDHHDQE AATAAALHHD  240
QHVRRLDHIV AGRPPPPPAS SSSGGGGGGG GDTMASSLDW LLASRRQEQH KYGDRHYEDD  300
DGGYYTAAHR GQAAAAMSAA AAAASGVVKD RRPSLEMSLG REGWEISMEQ RSSVESSSKE  360
LTLLKCL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1097270.0AK109727.1 Oryza sativa Japonica Group cDNA clone:002-146-B09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618990.10.0uncharacterized protein LOC4352677
TrEMBLA0A0D3HWA40.0A0A0D3HWA4_9ORYZ; Uncharacterized protein
STRINGOBART12G17540.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.25e-30G2-like family protein